(data stored in ACNUC30630 zone)

EMBL: CP001977.PE122

CP001977.PE122       Location/Qualifiers
FT   CDS_pept        144395..145078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3124"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99635"
FT                   /db_xref="GOA:D4HF62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF62"
FT                   /protein_id="ADD99635.1"
FT                   /translation="MRILIADDDPQFLRALRITLGARGYEVLLARDGQHALEMAIDHKP
FT                   DIILLDLGMPRLDGVKVIEAVRGWSSAPILVISGRSGSAEKVEALDAGADDYVTKPFSM
FT                   DELLARIRVLTRRIGQDEVDEEPIVAFGSVWVDLAAHTVTRDGANVRLTPTEWRVLELL
FT                   IRNEGRLVTRQTMLSQVWGSEHVTDTGYLRLYISQLRKKLEPEPSRPRYLITDAGMGYR
FT                   LVLDP"
     atgagaattc ttatcgctga tgacgacccg caatttttgc gagccttgcg gatcactttg        60
     ggcgccaggg gatacgaggt cttgttggcg cgtgatgggc agcacgcctt ggagatggcc       120
     atcgatcaca agccggacat cattttgctg gatctcggaa tgccgcgtct cgacggggta       180
     aaggtcattg aggcggtgcg cggctggtcg tcggcgccga tcctggtgat ctcgggacga       240
     tccgggtcgg ccgagaaggt ggaagccctt gacgctgggg ctgacgacta cgtcaccaaa       300
     ccattctcga tggatgagtt gcttgcccgt atccgcgtgt tgacaaggcg tattggccag       360
     gacgaggtag atgaggaacc aatcgtcgct ttcgggtcgg tgtgggtgga tctggctgcg       420
     cacaccgtga cccgtgacgg ggccaatgtc aggctgacgc cgaccgagtg gcgggtgctg       480
     gagctgctca tccgtaatga aggtcggctg gtgactcgtc agaccatgct gagtcaggtc       540
     tggggctccg agcacgtcac cgacaccggc tacctgaggc tctacatttc ccagttgcgc       600
     aagaagctgg agcccgagcc gagtaggccg cggtatctca tcactgatgc cggaatgggg       660
     taccggttgg tgcttgaccc ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page