(data stored in ACNUC30630 zone)

EMBL: CP001977.PE124

CP001977.PE124       Location/Qualifiers
FT   CDS_pept        145817..146155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3126"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00901"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF64"
FT                   /protein_id="ADE00901.1"
FT                   /translation="MLWTLGVSLSAHLRWLNISDRRRSLRTLRNANRRLCNQAFFIKIY
FT                   IDEDDQLRVENNRPFEMLLDPQINANALTWAQNGNKARIETKGFEPCAWGYLDVHFDTR
FT                   IWVGARRG"
     gtgttgtgga ctctcggggt cagtctgtcc gctcacttga gatggcttaa catttctgac        60
     cgacgccgaa gtctacgaac gctgcgaaac gccaaccgac gcctttgcaa ccaagccttc       120
     ttcatcaaga tctacatcga cgaagacgac caactccgcg tcgagaacaa ccgacctttc       180
     gaaatgctcc tcgaccctca gatcaacgcc aacgccctca cctgggccca gaacggcaac       240
     aaggcccgaa tcgaaactaa ggggttcgag ccttgtgcgt ggggttactt agacgttcat       300
     tttgatacaa ggatctgggt gggtgcacgg aggggctag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page