(data stored in ACNUC30630 zone)

EMBL: CP001977.PE130

CP001977.PE130       Location/Qualifiers
FT   CDS_pept        complement(151214..151462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3132"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99070"
FT                   /db_xref="GOA:D4HF70"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF70"
FT                   /protein_id="ADD99070.1"
FT                   /translation="MAREITRERVVELRCRGASYGQIATRLGMSRNTVKSICRRADINI
FT                   DPAVDVEPAKACEHCNGHFEAAVAGQRFCSDVCRLSW"
     atggcacgtg agattacccg tgagcgagtt gtggagctgc gatgccgagg cgcatcgtat        60
     gggcagatcg ccaccagatt gggcatgtcg cgcaatacgg tgaagtcgat ctgtcgcaga       120
     gctgacatca acatcgatcc ggcggttgat gttgagcctg ctaaggcatg cgaacactgt       180
     aatgggcatt ttgaagctgc ggtggcgggg caaaggttct gttcggatgt gtgtcgtttg       240
     tcgtggtag                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page