(data stored in ACNUC30630 zone)

EMBL: CP001977.PE141

CP001977.PE141       Location/Qualifiers
FT   CDS_pept        163636..164763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01045"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF81"
FT                   /protein_id="ADE01045.1"
FT                   /translation="MPQTGADREVRRCIYHVPYPLDPSTTFGGQKRAVAMLKALTQWGE
FT                   VWVVAGDARQRRRQIQVVMNAIRAGTRFEFCYSESSTMPTTLTEPHHLPTHPLEDFAFL
FT                   TRLRRHGIPVGLFYRDVYWKFPLYGEGVPKAKQLVAQAMYRYDLLAYRQCLDVLFLPSL
FT                   RMGEWVDVGDRVKKVALPPGHDIDETPTATPPSPLSMFYVGGLGSLYDLRAFCEAVASV
FT                   PEASLTICTRPKEWEQARKDYEPLMGNNIKVVHANGKKELEPYFAAANVAVLAMAPHEY
FT                   RDFAAPLKLFEYIGNGKPIIATEGTFVGDVVTRDELGWTVQASVNEFAALLEQLTQHPE
FT                   RVDEACDRVMAARDQHTWAARVEELVTALAAVDQR"
     atgccacaga ccggcgctga tcgcgaggtc cgacgctgca tctaccacgt cccctaccca        60
     ctggacccga gcacgacttt cggtgggcag aagcgcgctg tggcgatgct caaagccttg       120
     acgcagtggg gcgaagtgtg ggtggttgct ggtgacgccc gtcagcggcg ccgccaaatt       180
     caggtggtca tgaacgctat ccgtgctggc acccgattcg agttttgcta ttcggagtcc       240
     tcgacgatgc ccacgactct taccgagccc catcacctgc ccacccaccc tttggaggac       300
     ttcgccttct tgacccgctt gcgtcggcac ggcattccgg taggtctgtt ctatcgggac       360
     gtctactgga agttcccgct ctacggtgag ggagtcccga aggccaaaca gctcgtggcg       420
     caggcgatgt accgctacga cttgctcgcc tatcggcagt gcctcgacgt ccttttccta       480
     ccttcactgc gtatggggga gtgggttgac gtcggtgatc gagtgaaaaa ggttgccctg       540
     ccccccggcc acgacattga cgagaccccg acggccaccc cgccatcgcc actgtcgatg       600
     ttctacgtcg gtggactggg gtccctttac gacctgcgtg ccttctgcga ggcagtcgcc       660
     agtgtccccg aggcatccct gacgatttgc acccggccta aggaatggga acaggcgcgc       720
     aaggactacg agccccttat ggggaacaac attaaggttg tccatgctaa cggcaagaag       780
     gagttggagc cctacttcgc ggcggccaat gtagccgtct tggcgatggc tccgcatgag       840
     taccgagact ttgcggctcc gctcaaactt ttcgagtaca tcggcaacgg gaagccgatc       900
     attgccaccg agggcacctt cgtcggggat gtcgtgacgc gcgacgaact ggggtggacg       960
     gtgcaggctt ccgtgaacga gttcgcggcc ctcctggaac agctcaccca acatccggag      1020
     cgggttgatg aagcttgcga ccgggtcatg gccgcacggg accagcacac ctgggcagcc      1080
     cgggtggagg agctggtcac ggccctggct gcggtggatc aacgatga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page