(data stored in ACNUC30630 zone)

EMBL: CP001977.PE144

CP001977.PE144       Location/Qualifiers
FT   CDS_pept        167006..167623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3147"
FT                   /product="bacterial transferase hexapeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3147"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99910"
FT                   /db_xref="GOA:D4HF84"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF84"
FT                   /protein_id="ADD99910.1"
FT                   /translation="MGEPRIIDTADLDDGVTIGDGSSIWHLSQVRSEAVLGQNVVVGRG
FT                   AYIGEGVHVGDNCKIQNYALVYEPAKLEDGVFIGPAVVLTNDHFPRAINPDGSLKSADD
FT                   WEQVGVTCKRGCSVGARSVCIAPVTIGEWATVAAGSVVTKDVPAYALVAGVPARRIKWV
FT                   GRSGFPLDPDGENKWIDSRTGDRFIEDPATDTLTLVSEGEQA"
     atgggtgaac cacggatcat cgacaccgcc gacttggacg acggtgtgac catcggcgac        60
     ggttcgtcga tctggcatct ttcccaagtt cgcagcgagg ccgtcctcgg gcagaacgtc       120
     gtcgtgggcc gcggtgccta catcggcgag ggcgtccacg ttggcgacaa ctgcaagatc       180
     cagaattacg cgttggttta cgagcccgcg aagctggaag acggggtatt catcggaccg       240
     gcagtggtgc ttaccaacga ccacttcccg cgggctatca accccgacgg ctccctcaaa       300
     tctgctgacg actgggagca ggtgggtgtg acctgcaagc gtggctgctc tgttggcgcc       360
     cgttcggtgt gcattgcgcc tgtcactatt ggtgagtggg ccacggtggc tgccggctcg       420
     gtcgtcacca aggatgtccc ggcatatgcc ttggtggccg gcgtcccggc ccgtcgcatt       480
     aagtgggtgg gccgttccgg attcccgcta gatcccgacg gtgagaacaa gtggatcgac       540
     tcgcgtaccg gagaccggtt catcgaggat cctgccaccg atacgctgac cctggttagc       600
     gagggcgagc aggcctaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page