(data stored in ACNUC30630 zone)

EMBL: CP001977.PE146

CP001977.PE146       Location/Qualifiers
FT   CDS_pept        168819..169811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3149"
FT                   /product="oxidoreductase, NAD-binding domain protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00679"
FT                   /db_xref="GOA:D4HF86"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF86"
FT                   /protein_id="ADE00679.1"
FT                   /translation="MANLRAGMVGIGSMGKNHVRNLRAIDGVDLVAIADASGKDPFGVA
FT                   GDLPVLPDVDAVIETGIDYCVVAAPTKFHEEIGLKLAEAGVHALIEKPLAYDTAAATRL
FT                   AEAFESKGLVGAVGHIERYNPALQSLRKRLENGDLGDLYQVATRRQGPFPARIADVGVV
FT                   KDLASHDIDLTAWVTQRQFELVAARTMFKAGRDYEDMVSATCQLSGGLMSNHLVNWLTP
FT                   TKERRTFVTGEKGMFVADTLTADLTFYSNAKVATVWDDIANFRGVAEGDVTRFAIPKPE
FT                   PLRTEHENFRDAVLGKESDIVTMTQGATVVQVCEAMITSAATGEFVKIS"
     atggcgaatc tgcgcgccgg catggtcggc atcggttcga tgggcaagaa ccacgtccgc        60
     aacctgcgcg ccatcgacgg cgtcgatctg gtcgcgatcg cggatgcctc cggcaaggac       120
     ccgtttggag tcgccggtga cctacccgtt ctccccgacg tcgatgcggt catcgagact       180
     ggtatcgact actgtgtcgt cgctgccccg acgaagttcc acgaggagat cggtctcaag       240
     ctggctgagg cgggggtcca cgctctcatc gagaagccgc tggcctacga cactgcggct       300
     gcgactcgtc tggctgaggc ctttgagagc aagggtctgg tgggcgcggt cggccatatc       360
     gagcgataca acccggcttt gcagtcgttg cgtaagcgtc tggagaacgg cgacctcggt       420
     gacctctacc aggtggctac ccgccgtcag gggccattcc cggcccgtat cgctgacgtc       480
     ggcgttgtca aggacctcgc tagccacgac attgacctca ccgcgtgggt tacccagcgt       540
     cagttcgagt tggtcgccgc tcgcaccatg ttcaaggctg gccgcgatta cgaggatatg       600
     gtctcggcga cttgccagct ctcgggcggg ctcatgagca accacctcgt caactggctg       660
     accccgacta aggagcgtcg caccttcgtg accggcgaga agggtatgtt cgtcgcggac       720
     actctgaccg ccgacctcac cttctactcc aacgccaagg ttgcgacggt atgggacgat       780
     atcgctaact tccgtggtgt tgccgagggt gacgtgacca gattcgcgat cccgaagccc       840
     gaaccactac gcaccgagca tgaaaacttc cgtgacgcgg tgctgggcaa ggaatccgac       900
     atcgtgacga tgacccaggg cgccacggtc gtccaggtgt gcgaggcgat gatcacctcc       960
     gccgcgaccg gcgagttcgt caagatctcc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page