(data stored in ACNUC30630 zone)

EMBL: CP001977.PE152

CP001977.PE152       Location/Qualifiers
FT   CDS_pept        complement(175677..177689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3155"
FT                   /product="putative ATP synthase F0, A subunit"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM PF02379; match to protein family HMM TIGR00829;
FT                   match to protein family HMM TIGR00848; match to protein
FT                   family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99558"
FT                   /db_xref="GOA:D4HF92"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF92"
FT                   /protein_id="ADD99558.1"
FT                   /translation="MSTPLITPELVSLDANLGSTKTEVITSVAGLIAAAGRADADGLAH
FT                   DALDRESKSPTGMPGGFAIPHCRSAAVSQVSLGFARLSPAVDFNGPDGPADLIFMIAAS
FT                   EDGGADHMKLLTKLARALVNPEFVEQLRQAPDAQTVVDLIGGVVEPKEEASTSSATALP
FT                   APGHAAVTNAASDTPRIVAITACPTGIAHTYMAADYLRAAGKKLGVDVKVEPQGSTATE
FT                   PLSTDDIEGADAVIFATDVGVKGRERFAGKPVIESGVKRAVDEPEKMISEAVAASKDPH
FT                   AHRVPAGHGEQQEPEQAGSHIGWGKRIQQALMTGVSYMIPFVAAGGLLIALGFLFGGYE
FT                   IAKDGMDIALHNTFSNLPTPTAHALGGSATMTYIGAVLFAVGQAAFGFLLPALAGYIGF
FT                   GLADRPGIAPGFVAGAVAGVTGAGFIGAIIGGLLGGFVAYWFTRLNPPRWLRGLMPVVI
FT                   IPLVGSLVAGGLMYVVLGRPLAALTNALNNWLGGMSGASAVILGIVLGLMMCSDLGGPI
FT                   NKAAYLFATTNLAVTNVGSLKVMAAVMAAGMVPPLAMALSTTLRPKLYQPAERENGTAA
FT                   WLLGASFISEGAIPFAAADPLRVIPSMMVGGAITGALSMALGAASKAPHGGIFVFFAID
FT                   RVWAFILAIVVGTLVAALLVTALKASARRKAAAAA"
     atgagcactc ctctcattac cccggaatta gtatctcttg acgccaacct cggctcgacc        60
     aaaaccgagg tcatcacctc agtcgccgga ctcattgctg ccgctggacg cgccgatgct       120
     gacggcctcg cccacgacgc tctggaccgc gagtccaaaa gcccgaccgg tatgcccggc       180
     ggattcgcca tcccccactg ccgctcagcc gcggtatctc aggtatccct ggggttcgcc       240
     cggctatcgc ccgctgtcga cttcaatgga cctgacggcc cggccgacct catctttatg       300
     atcgcggcct ccgaagacgg cggcgcggac catatgaaac ttctgaccaa gctggctcgc       360
     gccctcgtca atcctgagtt cgtcgagcag ttgcgtcagg cccccgacgc gcaaaccgtc       420
     gtcgacctca tcggtggggt cgtcgagccg aaggaagaag cctcgacctc atctgcaacg       480
     gccctccccg ctcctgggca cgccgcggtg accaatgccg cctccgatac gccccgcatc       540
     gtcgccatta cggcctgtcc caccggcatc gcccacactt acatggcagc cgactatttg       600
     agggctgctg ggaagaagct gggtgttgac gtcaaggtcg agccccaagg gtccaccgcc       660
     accgagcctc tcagcaccga cgacatcgag ggtgctgacg ctgtcatttt cgccaccgac       720
     gttggtgtca agggccggga gcgcttcgcc ggaaagccag tcattgagtc cggggtgaag       780
     cgggccgtcg acgagcctga gaagatgatt tcggaggccg tcgccgcctc caaagaccca       840
     cacgcccatc gggtccccgc tggccatggt gaacagcagg agcccgagca ggctggatct       900
     cacattggct ggggcaagcg catccagcag gccctcatga cgggcgtgtc ctacatgatt       960
     ccgttcgtcg ccgcaggtgg tctgctcatc gccctgggat tcctcttcgg cgggtatgag      1020
     attgccaagg acggcatgga tattgccttg cacaacacct tcagcaacct gccgacgcca      1080
     accgcccatg ctctaggcgg atcagccacc atgacctaca tcggcgcggt ccttttcgcg      1140
     gtcggacaag cggctttcgg cttcttgcta cctgccctcg ctgggtatat cggcttcggc      1200
     ctggcagacc gccccggcat cgcccccggt ttcgtagcgg gtgccgtcgc tggggtgacc      1260
     ggggcgggat tcatcggtgc catcatcggt ggtctgctcg gcggtttcgt cgcctactgg      1320
     ttcacccgtc tcaacccgcc gcgctggctg cgtggcctca tgccggtcgt catcatcccg      1380
     ctcgtcgggt ccctggtcgc cggtgggttg atgtacgtcg tactgggacg tccgctggca      1440
     gccttgacga acgctctcaa caactggcta ggcggcatga gcggcgcctc ggccgtcatc      1500
     ctcggaatcg tcctgggact catgatgtgc tctgacctgg gcggccccat caacaaggcg      1560
     gcttacctct tcgcgacaac gaacctcgcg gtcaccaacg tcggatccct caaagtgatg      1620
     gccgccgtca tggctgccgg gatggttccc ccgctggcca tggcgctatc gacgaccctg      1680
     cgtccgaagc tctaccagcc tgccgagcgt gaaaacggca ctgctgcctg gctgctggga      1740
     gcctccttca tctccgaggg cgctatcccg ttcgcagctg cggatccgct acgagtgatt      1800
     ccctcaatga tggtcggagg cgcaatcacc ggtgccctgt caatggctct gggggccgct      1860
     tctaaagctc cccatggcgg aatcttcgtc ttctttgcca ttgatcgggt ctgggccttc      1920
     atcctggcca ttgtcgtcgg caccctcgtg gcagccttgc tcgtaaccgc tctcaaagcc      1980
     tcagctcggc gcaaggccgc ggctgccgcg taa                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page