(data stored in ACNUC30630 zone)

EMBL: CP001977.PE163

CP001977.PE163       Location/Qualifiers
FT   CDS_pept        complement(187780..189162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3166"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3166"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98958"
FT                   /db_xref="GOA:D4HFA3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4HFA3"
FT                   /protein_id="ADD98958.1"
FT                   /translation="MGINNLLSDIGLPGLGCKPVLTDSKPRVVIVGAGFGGLAAAEKTA
FT                   EAGCDVTLIDRNPYTTFQPLLYQVATGGLNPGDVTYRLRSFAANNGPHTHFRRACVTGI
FT                   DTENRIVEVDNGDPISYDYLVLSQGVGANFFGTPGAAENSYTIYTRASSLRARDAIFTY
FT                   LEDLDTQRDKTFDVIIVGGGPTGVEMAGTLAEMKSIGIPAIFPDVSTDRVHVTLVEMAN
FT                   HLLMPFDPALRHYTRRQLQKRGVDVRTNTAIAEVREDSVLLKDGQTLPADMVIWAAGVG
FT                   AHKSVTNWGFEQGRGGRIATDGTLLVKGQDRIFAVGDGAINTEDPKPQLAQPAIQGGEC
FT                   VARQIVHLELGEPLEKFEYNDKGTMATIGRNSAVVQLSEKLKFTGIGAWLTWVTVHIFT
FT                   LLGGRNRLQAMINLGARYIAFHREAGAIVGDVLSEEGKENMNKNALRDDDEKGAKPIDG
FT                   KE"
     atgggcatca ataacctgtt gtcagacatc ggcctgccgg gcctgggctg caaaccggtt        60
     ctgacggact ccaagccccg agttgtcatc gtcggcgccg gattcggcgg cttggctgct       120
     gccgaaaaga ctgccgaggc aggatgcgac gtcaccctca tcgaccgcaa cccgtacacc       180
     acattccagc cgctgctgta tcaggtggca accggcggtc tcaaccctgg cgatgtcacc       240
     taccgacttc gctccttcgc cgctaacaac ggtcctcaca cccacttccg tcgcgcttgt       300
     gtgaccggta tcgataccga gaaccggatt gtcgaggtcg acaacggcga cccgatctcc       360
     tacgactacc tcgtcctgtc ccagggcgtc ggggccaact tcttcggaac ccctggtgcc       420
     gccgaaaact cgtacaccat ttacacccgt gcatcctcac tgcgcgctcg cgacgcgatc       480
     ttcacctacc ttgaggatct cgacacccaa cgtgacaaga ccttcgacgt catcatcgtt       540
     ggcggcggcc cgaccggcgt cgaaatggcc ggcaccctcg ccgagatgaa gtcaatcggc       600
     atcccggcga tcttcccgga tgtgtccacc gaccgggtcc acgtgacgct cgtcgagatg       660
     gccaaccacc tcctcatgcc cttcgaccca gcgctgcgcc actacacccg ccgccaactg       720
     cagaagcgcg gcgtggatgt gcgcaccaat accgccatcg ctgaggtgcg cgaggattcc       780
     gtgctcctca aggacggcca gactctcccg gccgacatgg tcatttgggc cgctggcgtc       840
     ggtgcccaca agtctgttac gaattgggga tttgagcagg gccgaggtgg ccgcattgct       900
     accgacggca ccctcctcgt caaaggccag gatcgcatct ttgctgtcgg cgacggtgcc       960
     atcaacaccg aggatcccaa gccccagctc gcccaacccg ccatccaggg aggcgagtgc      1020
     gttgctcgtc agatcgttca cctcgagctc ggcgagccgc tggagaagtt cgagtacaac      1080
     gacaaaggca cgatggcgac gatcggccgc aattcagccg tcgtgcagct gtccgaaaag      1140
     ctcaagttca ccggtatcgg tgcatggctg acgtgggtca ccgtgcatat cttcaccctg      1200
     ctgggcggcc gcaaccgtct gcaagccatg ataaacctcg gcgcccgcta catcgccttc      1260
     catcgcgagg ccggagccat cgtcggtgac gttctcagcg aggagggtaa ggagaacatg      1320
     aacaagaatg cccttcgcga cgatgatgag aagggcgcca aacccattga tgggaaagag      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page