(data stored in ACNUC30630 zone)

EMBL: CP001977.PE166

CP001977.PE166       Location/Qualifiers
FT   CDS_pept        191997..192431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3169"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99294"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y4"
FT                   /protein_id="ADD99294.1"
FT                   /translation="MFFFGTFLPHASRFSLAIQANLDCERVLIGSVLIPRGNDPTGLVC
FT                   DLTQLHRLPDSPESRNLEHPDIRLSRDLTMGDHFVGRLTFYCRVHYFHSFGIFTPARSS
FT                   CARTPTDVSWCPAGIDTRPAPPGRPQISWLPLAFRRRAHP"
     atgttcttct tcggcacctt cttgccacat gcttcgcgct tcagcctcgc catccaagcg        60
     aacctggact gtgaacgagt cctcatcggg tccgtcctca ttccacgcgg caatgatccc       120
     acgggcctcg tctgcgacct gactcaactt catcgcctgc ccgacagccc cgagagccgg       180
     aatctcgaac acccagatat tcgcctcagc cgagacctca cgatgggcga tcacttcgta       240
     ggtcgtctca ccttctactg tcgtgtccat tacttccact ccttcggaat tttcacgcct       300
     gctcgctcca gctgtgccag gacaccaact gacgtcagct ggtgtcctgc tggtatcgat       360
     acgcgcccgg ctccgccggg gcgtccccag atttcatggc ttcccttggc gttccgcaga       420
     cgggcccatc cttga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page