(data stored in ACNUC30630 zone)

EMBL: CP001977.PE168

CP001977.PE168       Location/Qualifiers
FT   CDS_pept        193966..194262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3171"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3171"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99890"
FT                   /db_xref="GOA:D4H8Y6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y6"
FT                   /protein_id="ADD99890.1"
FT                   /translation="MSDRIRQEDGSYVNGPAIAYDVLAGGSQAVNLVEAAKASGNIRIM
FT                   FAGRYRVTEWRGEQGTRIQHEVRADEVSVSLLGQRVTVERPRGDVASKESTSF"
     gtgtccgatc gcattcgcca ggaggacggc agctacgtca acgggccagc gatcgcctac        60
     gacgtcttgg cgggtggcag ccaagccgtg aatctggttg aagccgccaa ggcgagcggc       120
     aacatccgca tcatgttcgc gggccgttac cgcgtcaccg agtggcgggg tgagcagggc       180
     actcgtatcc agcatgaggt ccgagccgac gaggtgagcg tgagcctgct cggtcagagg       240
     gtgaccgtgg agcggcctcg aggtgacgtg gcatccaagg agagcacgtc gttctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page