(data stored in ACNUC30630 zone)

EMBL: CP001977.PE185

CP001977.PE185       Location/Qualifiers
FT   CDS_pept        206790..207533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3188"
FT                   /product="ABC-2 type transporter"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01191"
FT                   /db_xref="GOA:D4H903"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4H903"
FT                   /protein_id="ADE01191.1"
FT                   /translation="MNTCFRRYAAMSLRARRDLALTFIQPLVYLALFGPLFVTTMKMSQ
FT                   RATAATGYSLYITGLSIQMAMTIGAFAGLTIILEYRLGILERIWSTPLTGSKMMAGRIA
FT                   RDVVMMMMPILVVFIIGLVLGTRPSPLGLATYFVTVLGTGATFAGVSYAVALRTKSEAA
FT                   LSAIFNLILLPVLLLSGIMLPMSFAPHWIATAAHVNPLWYLVQGARNQFSVLGLVAAAP
FT                   WSWAVAIVMSAAAFGWASHEFNKRR"
     atgaacactt gcttcaggcg atatgcggcg atgtcgctga gagcgcggcg tgatttggcc        60
     ctgacattca tccagcccct cgtctaccta gccctcttcg gaccgctctt cgtcacgacg       120
     atgaagatgt cgcagagagc taccgccgct acgggttact ccctatacat cacgggcctg       180
     tccatccaaa tggccatgac gatcggtgcc ttcgcggggc taaccatcat cctcgaatac       240
     cgactcggca tcctcgaacg gatctggagc acccccctca cggggagcaa gatgatggcg       300
     gggcgaatcg cgcgcgacgt cgttatgatg atgatgccga tactggtcgt cttcatcatc       360
     ggcctggtgc tgggaacacg ccccagccca ctgggcctgg cgacctactt cgtgacagtg       420
     ctcggcacag gagccacgtt cgccggggtc tcctacgcgg tggcactcag aacgaagagc       480
     gaggcagcgc tatccgcgat cttcaacctc atcctgctac ccgtcctcct gctgtcgggg       540
     atcatgctgc ccatgtcgtt cgcaccacac tggatcgcca ccgctgccca cgtgaacccg       600
     ttgtggtacc tggtgcaagg cgcgcggaac cagttcagcg ttctagggct cgtggcggcg       660
     gccccatgga gttgggctgt ggccatcgtc atgtcagccg ctgccttcgg ctgggcaagc       720
     cacgaattca acaagaggcg ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page