(data stored in ACNUC30630 zone)

EMBL: CP001977.PE188

CP001977.PE188       Location/Qualifiers
FT   CDS_pept        complement(209281..210072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3191"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07512"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00024"
FT                   /db_xref="UniProtKB/TrEMBL:D4H906"
FT                   /protein_id="ADE00024.1"
FT                   /translation="MTAANDAPQVCEEGPGQNNGLGGIPIFRGIDLPEAYRHQSYHAPT
FT                   VSRETLQEWFSPARLSRYRIEPVDAWYVWNTRISKAFLEDISHVEVLLRNFIDVRLSAD
FT                   TGIRRWWESPSYRLGGFPRNVDRAEKRLRRARLDATPDQIVASLSLDNWRFLLTPRLEA
FT                   TVWKALTDLRNGGMPHYPGRSRRDFEENVELIRHVRNRASHQEPLISAHPDQQAEIRRL
FT                   AHYVTAIDTVARNINPDAAEWIATHSRVLDAIAQRPTPQDH"
     atgacggcag ccaatgacgc cccgcaagta tgcgaggagg ggcctgggca aaacaatggc        60
     ctcgggggta taccgatatt tcgcggcatt gaccttcccg aggcctatcg tcatcaatcc       120
     taccacgctc ccacggtgag tcgtgagacg ttgcaggagt ggttctcacc cgccaggctc       180
     agccgctacc ggatcgaacc agtcgatgcg tggtacgtgt ggaacacccg catctcgaaa       240
     gcgttcttgg aagacatcag ccatgtcgag gtactcctga gaaacttcat tgacgtgcgc       300
     ctgagcgccg atactggcat acggcgttgg tgggaatccc cgagctatcg gctcggtggt       360
     ttcccgcgta acgtcgacag ggccgagaag cgactgcggc gcgcgaggct cgatgcgacc       420
     cctgatcaga tcgtggcgag tctgtcactg gacaactggc gctttctgct caccccgcgc       480
     ctggaagcaa ccgtatggaa agctctcact gacttacgta acggaggtat gcctcactac       540
     ccggggcgta gccgacgcga cttcgaggaa aacgtggagc tcatccgcca cgtccgtaac       600
     cgcgcctccc atcaagagcc cctcatcagc gctcaccctg accaacaagc tgagattcgc       660
     aggcttgccc actacgtaac agcgatcgac accgtcgccc gcaacatcaa ccccgacgcg       720
     gccgaatgga tcgccaccca ctcacgcgtt ctcgatgcca tcgcccagcg ccccacaccg       780
     caagaccatt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page