(data stored in ACNUC30630 zone)

EMBL: CP001977.PE200

CP001977.PE200       Location/Qualifiers
FT   CDS_pept        225404..225721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3204"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01910"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99550"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D4H918"
FT                   /protein_id="ADD99550.1"
FT                   /translation="MIVAFSLVPSGGRASREDGGVADAVAAAVRVVRDSGLPNHTSSMF
FT                   TEIEGSWDEVMDIVKRATEAVAQYGTRVSLVLKADIRPGRTGEMTAKLERLQGELDKQH
FT                   N"
     atgatcgttg ccttcagtct tgttcccagt ggtggccgag cttcacggga ggacggtggc        60
     gttgccgacg ccgttgctgc tgctgtcaga gtggttcgcg attctgggct gcccaaccac       120
     acttcgtcga tgttcactga aatcgagggc tcgtgggatg aggtcatgga tatcgttaag       180
     cgggctaccg aagcggttgc gcagtatggc actcgggtgt cgcttgtact caaagccgat       240
     attcgtcccg ggcgtaccgg tgagatgacg gccaaactgg agcgactcca gggggagctg       300
     gataagcagc acaactga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page