(data stored in ACNUC30630 zone)

EMBL: CP001977.PE203

CP001977.PE203       Location/Qualifiers
FT   CDS_pept        228643..229437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3207"
FT                   /product="cysteine-rich domain protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99784"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D4H921"
FT                   /protein_id="ADD99784.1"
FT                   /translation="MTTTTSPGARATLPGLPGAGMTVGLFITCINDVMFPQTGVAVTTL
FT                   LERLGCKVEFPREQTCCAQMTTNTGYFDEGIPTVRQYVRAFGDYDYIVAPSGSCVAAVR
FT                   DQHPMLAEYAGDSGLAKEVEHTSQCTYDLPEFLVDILGVTDVGAYFPHRVTYHPSCHGK
FT                   RLLNLGDRPYELLRHVKGMTLVDLPMAEQCCGFGGTFCIKNPDMSAAMANDKARHVRET
FT                   EAEYVVAGDNSCLMNIGGVLSRQNSGVKPIHIAEILANTEED"
     atgacaacca ctacaagccc tggcgccagg gctaccttgc ccggcttgcc gggggcgggt        60
     atgaccgtcg ggctgttcat tacgtgcatc aatgacgtga tgttccctca aacgggcgtg       120
     gccgtcacca ccctgttgga gcgcctcggc tgcaaagttg agttcccacg ggaacagacc       180
     tgttgcgccc agatgacgac caacaccgga tacttcgacg agggtattcc gaccgtccgt       240
     cagtatgtgc gagccttcgg agactacgac tatatcgtcg caccctcggg gtcctgtgtc       300
     gccgccgtcc gtgatcagca cccgatgctt gccgagtatg ccggagattc tggtctggcc       360
     aaggaggtcg agcacaccag tcaatgcacc tacgatctac ccgagttcct cgtcgacatt       420
     ctcggggtca ctgacgtcgg cgcatatttc ccgcatcggg tgacgtatca cccgtcctgc       480
     cacggcaagc ggctgctgaa ccttggtgat cgtccctacg agctgctgcg tcacgtcaaa       540
     ggcatgaccc tggtcgacct tccgatggcc gagcagtgct gcgggttcgg tggcaccttc       600
     tgcatcaaaa accccgatat gagcgcggcc atggctaacg acaaggctcg ccacgtccgc       660
     gagactgagg ctgagtacgt cgtcgccggc gataactcct gcctcatgaa tatcggtggt       720
     gtgctgtcgc gccagaactc gggcgttaag ccgattcaca tcgccgaaat cctcgccaac       780
     actgaggagg actga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page