(data stored in ACNUC30630 zone)

EMBL: CP001977.PE205

CP001977.PE205       Location/Qualifiers
FT   CDS_pept        230973..231653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3209"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99788"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4H923"
FT                   /protein_id="ADD99788.1"
FT                   /translation="MTTISTDPVARTEILARIRPASTDITNSDPVADVPIEWEYGTGID
FT                   MDDVVGTFVEKVIDYKATVVRVKGADVPQAVVEGLRSTGAEHSAVVPVGLDKSWVGAIK
FT                   TAGFDARLDDPQLSKKELNDTDAVVTGAACGIADTGSIVLTHVEDQGRRAITLVPDRHV
FT                   CVVKASQVVSDVPEAIQIVKPAVHEGHPLTFISGGSATSDIELSRVDGVHGPRRLYVIV
FT                   VDDR"
     atgaccacaa ttagcactga tccggtggcg cgtaccgaga tcctcgcccg gattcgtccc        60
     gccagcactg acatcaccaa ttctgacccg gtcgcagatg tgccgatcga gtgggagtac       120
     ggcactggca tcgacatgga cgacgtggtt ggcacctttg tcgaaaaggt catcgactac       180
     aaggcgaccg tcgtgcgggt caagggggct gacgttcccc aggccgtcgt tgaggggctg       240
     aggtctaccg gtgctgagca cagcgccgtc gttccggtcg gtttggacaa gtcctgggtg       300
     ggggcgatca agactgccgg gtttgacgcc cgcctcgatg atccgcagct atcgaagaag       360
     gagctcaatg acaccgatgc tgtcgtcacc ggcgctgcgt gtggtatcgc tgacacgggc       420
     agcatcgtgt tgacccacgt ggaggaccag gggcgtaggg ctatcaccct tgtcccggat       480
     cgccacgtct gcgtcgtcaa ggctagccag gtggtttccg acgtcccgga ggccatccag       540
     atcgtcaaac cggcggtgca tgagggacac ccgttgacct tcatttccgg tggttcggcc       600
     acctctgaca ttgagttgtc ccgggttgac ggagtgcatg ggcctcgtcg gctttatgtc       660
     atcgtcgtcg acgaccggtg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page