(data stored in ACNUC30630 zone)

EMBL: CP001977.PE22

CP001977.PE22        Location/Qualifiers
FT   CDS_pept        complement(24269..24979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3022"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00441"
FT                   /db_xref="GOA:D4HEI0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI0"
FT                   /protein_id="ADE00441.1"
FT                   /translation="MSIIKGILDVGAVVILPIVMLILCLIFRMPFGKSLKAGLMIGIGF
FT                   SGLSLVIGFLMTSVQSAVDYYRHMGGGFTTVDVGWAAVGAASFGVPFAAPAILLVVLIN
FT                   VVMILAKMTNVLNVDIWNFIRFLVPGTLAYALTNNAWIGLGVVLVLSVIDLIVAQHIAP
FT                   KWQEYYGLTGTTCSTLSYITSAWPIAIGLNWVIDKIPGVRKIDISMEKFGDRLGFFGDT
FT                   AFIGLIVGIFLWDS"
     atgtcaatta taaagggcat tcttgacgtc ggcgccgtgg ttatcctgcc gatcgtgatg        60
     ctgattcttt gcctgatctt caggatgcct ttcggtaagt ccctcaaggc cggtctgatg       120
     atcggtatcg gattctccgg actttccctc gtcatcggat tcctgatgac gtctgtgcag       180
     tcggcagtgg attactaccg gcacatgggc ggaggattca cgactgttga tgtcggctgg       240
     gcagcagtcg gcgcggcttc attcggagta ccctttgccg ctcctgccat cctccttgtc       300
     gtcctcataa atgttgtcat gatcctcgcg aaaatgacga acgtactcaa cgtcgacatc       360
     tggaacttca tccgtttctt ggtcccagga acgctggcct atgcactaac gaacaacgca       420
     tggatcggat taggtgtcgt cttggtgctt tcggtcattg acctcatcgt cgctcagcat       480
     atcgcaccaa aatggcaaga atactacggc ctcacaggga caacatgttc gactctttcc       540
     tacatcacgt cagcatggcc cattgcgatc ggattgaact gggtcatcga caaaatcccc       600
     ggagttcgta agatcgacat ctccatggag aaattcggcg acaggctcgg attcttcggc       660
     gacaccgcct tcatcggcct catcgttggt atcttcctct gggactcatg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page