(data stored in ACNUC30630 zone)

EMBL: CP001977.PE220

CP001977.PE220       Location/Qualifiers
FT   CDS_pept        249934..250764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3224"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05949"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99561"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D4H938"
FT                   /protein_id="ADD99561.1"
FT                   /translation="MSDDNDPDDVRPDDASVDIDEDRSQATTDPSIQDVRSDSRHPRLA
FT                   RSASVIVMALAGLMMTTAATNSRGHDLRPERDTDMATLVRSQASHNAALQKEAAGLRAQ
FT                   VEDLSKANQTPGVTSSVISSASALAPSVGLEAVSGKALRVTLDDAPLSENPDGVDANML
FT                   VVHQQDIQMVVNTLWSGGAEAMTIQGQRVISTTAVKCVGNTVVLHGVAYAPPYVIEAIG
FT                   DLNAMQKALDTSEAVRIYKEYVSAYQLGWSVERAGQVTMPAYTGAVAVSHATPR"
     atgagcgacg acaacgaccc tgatgacgtc cgtcccgacg acgcatccgt cgatatcgac        60
     gaggataggt cgcaggctac gacagacccc tctattcagg acgtccgttc ggattcgcgg       120
     caccctcgtc tagctagatc cgccagcgtg attgtcatgg ccctggctgg tctcatgatg       180
     acgacggctg ctaccaattc acgcggtcac gatcttcggc ccgagcgtga taccgacatg       240
     gccaccctgg tgcgtagcca ggccagtcac aacgccgcct tgcagaagga ggcagccggt       300
     ctgcgggcgc aggtggaaga cctttccaaa gctaatcaga ctccgggcgt cacgtcctcg       360
     gtcatctcgt cggcgtcggc tttagcgccg tccgttggtt tggaagctgt cagtggtaaa       420
     gccctgcgcg tcacgctcga cgacgcgccc ctcagcgaga atccggatgg ggtcgacgcc       480
     aacatgctgg tcgtccacca gcaggacatc cagatggttg tcaacacctt gtggtctggg       540
     ggagcagagg ccatgaccat tcaggggcag cgagtcatct ccaccacagc cgtgaaatgc       600
     gtcggtaata ccgtggtcct gcatggcgtg gcctacgctc ctccctacgt catcgaggcg       660
     atcggggacc tcaacgccat gcagaaagct ctcgacacct ctgaagcggt gcgtatttac       720
     aaggaatacg tgagtgctta ccagctcggg tggtcggtgg agagagctgg ccaagtcacc       780
     atgcctgcct acaccggcgc cgttgctgtg agtcacgcca cgccgcgttg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page