(data stored in ACNUC30630 zone)

EMBL: CP001977.PE222

CP001977.PE222       Location/Qualifiers
FT   CDS_pept        complement(252800..254227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3226"
FT                   /product="penicillin-binding protein, transpeptidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01189"
FT                   /db_xref="GOA:D4H940"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4H940"
FT                   /protein_id="ADE01189.1"
FT                   /translation="MNRQIRAVSLLAGLMFLALMVNLTGSAMFRQASLNNDPHNVRVRD
FT                   AEFSQNRGNILVGSRPIATTTSSNGKFAYQRVYLSGPKYAPITGYYSYYYGRSMLEQTQ
FT                   NAQLTGTSDAQWLSRITGTLSGHKPEGGSITTTINAKAQDAAWDGLKGKKGAVVALDYT
FT                   TGAVLAMASSPSYDPNELASHHLNDTTRAWKNLVADPSSPLTNRATREIYPPGSTFKLV
FT                   TAAAALQNGYHPNSMVDSPENWILPGTRTPLTNETNCGGSRITLAHALDISCNTAFGKV
FT                   GVSLGQDKIRDQAERFGFGKVVNSDVSSAASRFPQNLTDAQLAQSSIGQYDVAASPLQM
FT                   AMVTAGIANGGKLMTPYLTAQVRASNLQVVSEHHPKQMSQPMTKESAEQLKAMMASVVN
FT                   NGTGKRARINGTTVGGKTGTAQTVKGKAPYAWFVGWSDNPHVAVAVFIQSSDTAINEVS
FT                   GGRLAAPIARDVIEAMR"
     atgaatagac aaattcgcgc agtctctttg ctcgccgggc tgatgttcct ggccctcatg        60
     gtcaacctca caggttcggc tatgttccgg caggccagtc tcaacaacga tccccacaac       120
     gtccgggtgc gtgacgcgga gttctcccag aaccgcggca atatcctcgt cggttcgaga       180
     ccgatcgcca ccacgacgtc aagcaatggc aagttcgcct atcagcgtgt gtacctatcg       240
     gggccgaagt acgcacccat caccgggtat tactcctact actacgggcg atccatgctg       300
     gagcagaccc agaacgccca gctcaccgga acctccgatg cccaatggct ctctcgcatc       360
     accggcacct tatctggcca caaacctgaa ggcggctcta tcaccacgac gattaacgcc       420
     aaagcacagg atgccgcgtg ggacggactc aagggaaaga agggcgctgt cgtcgcattg       480
     gactacacca ccggcgcggt gctggctatg gcgtcgtccc cctcctatga tcccaacgag       540
     cttgcctccc accacctcaa tgacaccacc cgagcatgga agaacctcgt tgcggacccg       600
     tcgtctccgc tgacgaaccg cgcgacccga gaaatctacc ctccggggtc aacattcaaa       660
     ctggtgaccg ccgcggcagc tctccagaac gggtaccacc cgaattccat ggtcgactca       720
     ccggaaaatt ggatcctgcc gggcactcgc accccgctga cgaacgagac caactgtggg       780
     ggcagcagga tcaccttggc ccacgccctt gacatctcgt gcaataccgc cttcggtaaa       840
     gttggcgtga gcctgggcca agacaagatc cgagatcagg ctgagcgatt cgggtttggc       900
     aaggttgtca actccgatgt gtcctcagcc gcatcaagat tcccgcagaa cctcaccgat       960
     gcgcagttgg cgcagagctc catcggccag tacgacgtcg cagcctctcc gctgcaaatg      1020
     gccatggtga ctgccggcat cgccaatggc ggcaaactca tgacccctta cctcaccgcg      1080
     caggtgagag catcaaacct gcaggtagtc tccgaacatc acccgaagca gatgtctcaa      1140
     ccgatgacaa aggagtcggc cgagcagctg aaggcgatga tggcctcggt ggtcaacaat      1200
     ggcactggca agagggcgcg cattaatggg accaccgtcg gcggtaagac cggcaccgcc      1260
     cagacggtaa aaggtaaggc cccctatgcg tggttcgtcg gatggtcgga caacccgcac      1320
     gtcgcagtag cggtcttcat ccaatcttcg gacaccgcca tcaatgaagt ctcaggaggc      1380
     cgactcgcgg ctcccatcgc tagagatgtc atcgaggcga tgagatga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page