(data stored in ACNUC30630 zone)

EMBL: CP001977.PE234

CP001977.PE234       Location/Qualifiers
FT   CDS_pept        267262..268107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00117"
FT                   /db_xref="UniProtKB/TrEMBL:D4H952"
FT                   /protein_id="ADE00117.1"
FT                   /translation="MAGRNNDLRTLYSHWTGQIRKSRLGVLLVPDADYDGDLLDVRLPR
FT                   HPAATVNKGTLKYSLTYRTIKQPLSGDVLEVVTSARSCPDATWDGTAKVVPHSPALTSI
FT                   DAKCGWTITLKTLPQEEPVTVTAKFPATEAAISNQANLQTWLQNQQQATDKALNNDAVT
FT                   STAYSLQRLQTMRIKIPPRVKEGSAIPVTILGTWPGGENEMTPIYTTPFSSNPTSILTD
FT                   ITGGKLENVRLTDRCSGAVSITPDGHDVSALHPASCSIGAEIGNYQVQESPITIVAGGS
FT                   "
     gtggctgggc gtaataatga tctgcgcacc ctgtacagcc actggacggg gcagatccgt        60
     aagtcccggc tgggagtcct gctagtgcca gatgctgatt atgacgggga cctgctggat       120
     gtacgtctgc cgagacaccc ggcggcgacg gtcaacaagg gaacattgaa atactccctc       180
     acctatcgca ctatcaagca gccgctgagc ggagacgtcc tcgaggtggt cacgtcggcc       240
     cgttcctgcc ctgatgctac gtgggatggc actgccaaag ttgtgccgca tagtccggcg       300
     ctcacttcga ttgatgccaa atgtgggtgg acgatcacgc tgaagactct cccacaggag       360
     gagccggtga ccgtcacggc gaaattccca gcgacggaag cggcgatcag caatcaggca       420
     aacctgcaga cttggctgca aaatcagcag caagctaccg acaaggcact gaacaatgac       480
     gctgttacct caactgcgta ctctttgcaa cggttgcaaa cgatgcggat caagataccc       540
     ccgcgggtca aggaaggatc cgcgatcccg gtgacgatct tgggcacctg gccgggtggt       600
     gaaaatgaga tgacgccgat ctacaccacg cctttcagct caaatccgac gagcatcctc       660
     accgacatca caggaggtaa gttggagaac gttcggctca cggatcgttg ttcgggtgca       720
     gtgtctatta ccccggacgg tcacgacgtg agtgctctgc atccggcttc gtgcagcatc       780
     ggtgcagaga tcgggaatta tcaggtgcag gagagcccga ttaccattgt tgccggtgga       840
     tcgtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page