(data stored in ACNUC30630 zone)

EMBL: CP001977.PE247

CP001977.PE247       Location/Qualifiers
FT   CDS_pept        284675..287317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3253"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99524"
FT                   /db_xref="GOA:D4H9J9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J9"
FT                   /protein_id="ADD99524.1"
FT                   /translation="MMSARTTPEMPTSAVRLSGDAIARGRPHRRLINRLAVRDIGRHKL
FT                   RSLLIVMLIALPVAIMSGLGVLLRSDGSVSGSQALNNYGDADMVISPISNWDGHCSQQG
FT                   PTNTYCDDGAEPDAHQRAQQQTALANLRLPGHKLHPLRTTEASVSWRLATLSATVKAMD
FT                   LTTMRPYRMEFPRGPMPTGNNIWVTTGAAKDYGWSVGSRVTVNGHRYTITGVVREEWPG
FT                   NGPTFWVAPRSPLARGGELTYYVNGASLTRQQVEKLNASGVGVADRRAEESASQGDTFE
FT                   RDMFALILAAGVLSAIVVATIAAAAFAIGARQQRRMLALLGITGAARRDLMGVMIHQGL
FT                   LLGLTGALLGVGLGVGMGDGAVAIIRIVYPDYITYGVDWGYAAVGSVVGLLAALTACWF
FT                   PARDVARQDALMGVKHAESAARPARRPTLAIVIAAIGLLAGVGGVIYGRRGTTGDVMVR
FT                   LNIGIIVTIVVLYLAAVSAMPWLVDKVSGRKSSRLPIRFALRDLNRNRGRAVPGVAASM
FT                   AITVLACAAVTFCDSLAIQDKAEYVPEFGDHIGVLAGEHDDGVRTSDDRVAGEIKRVTA
FT                   VFGPHVKYLRPEEPVTCGQDGKYCTSSLEVTPKVPNGAMSSTVAIDDGTLYELLTGEKA
FT                   DGRVMKALDDGVVLFSPDATRISQAIISDHDERHGAGTTVLPAIHAPHHALGYGVPNLI
FT                   SRRTAAKVLGVSPDNMKTQSTTVWLRLPHTPTAREGDRLQHSLMDVTGSPSEFIWEKGY
FT                   SDISGTVMRWSAVVGTLLAVCVGAVVLALTLSDSRGSRTAIASVGASKATLRRMVAAQA
FT                   LVTTGLGQILGFLVGFVPVAVMTCVGPRWPMPMPLPWLALIVFAPPVLLALVTMVAVPV
FT                   PRPRMQRLD"
     gtgatgtcag cccggaccac gcccgagatg ccgactagcg cggttcgcct ctccggagac        60
     gctattgccc gaggacggcc ccaccgccgt ctcatcaatc gcctggccgt acgtgacatc       120
     ggcaggcaca agttgcgctc cctacttatc gtgatgctca tagcgttacc ggtggccatc       180
     atgtccggat taggggtgct cctgcgctcg gatggcagtg tctccggcag ccaggccctc       240
     aataactatg gtgacgccga catggtcatc agcccgatat caaattggga tggtcactgt       300
     tcccagcaag ggccgactaa cacgtactgt gacgacggtg ccgagccaga tgcgcaccaa       360
     cgagcccagc aacagacggc tctggccaac ctgaggctgc ctggccacaa gctgcacccc       420
     ttgaggacta ccgaggctag cgtttcctgg cggcttgcca ccttgtcggc aacggttaag       480
     gcgatggacc tgacgactat gcgtccctac cgcatggagt tcccgcgtgg ccccatgcct       540
     accggcaata acatctgggt gaccaccggt gctgcgaaag attatggctg gtcggtgggg       600
     tcccgagtaa ccgtcaacgg gcaccggtac accatcactg gggtggtccg ggaagaatgg       660
     ccggggaatg gtccaacgtt ctgggtagcc cctcgcagcc cgttggcccg tggtggagag       720
     ctcacttatt acgtcaacgg tgcatcgctc acgaggcaac aagtcgagaa gcttaatgcg       780
     tccggggtgg gcgtcgccga ccgccgtgcc gaagagagtg ccagtcaagg agacaccttc       840
     gaacgggaca tgtttgcgct gatactggcc gctggggtgc tctcggctat tgtcgtagcc       900
     actatcgcag ccgcagcatt cgctattggc gctcgtcaac agcggcggat gctcgctctg       960
     ctcggcatta ccggggccgc tcgacgtgac ctcatgggtg tgatgattca tcagggactg      1020
     ctgttgggcc tgacgggggc cctcctcggg gtgggcctcg gcgtgggtat gggcgatggc      1080
     gcggtggcca ttattcgaat agtgtacccc gactacatca cctatggggt cgattgggga      1140
     tatgccgccg tcgggtccgt ggtcggtctg cttgcggcac tgaccgcttg ttggttcccg      1200
     gctcgtgacg ttgcccgtca agacgccctc atgggggtca aacatgccga atctgcggca      1260
     cggcctgcgc ggcgaccaac gttagcgatc gtcatcgcgg cgatcggtct gctcgctggt      1320
     gtcggtggcg tcatatatgg ccgtcgtgga acgaccggcg acgtgatggt gcgcctgaat      1380
     attggcatta tcgtcaccat tgtcgtgctg tacctggccg ctgtgtctgc catgccctgg      1440
     ttggtggaca aggtgtcggg acgcaaatcg tcgcggttgc cgatccggtt cgcgctgcgc      1500
     gatcttaacc gtaaccgagg acgggcggta ccaggggttg ccgcctccat ggctatcacc      1560
     gtgctggcat gcgccgccgt tactttttgc gacagtctcg ccatccagga caaggccgaa      1620
     tacgtcccgg agttcggaga ccacattggg gttctcgctg gtgaacacga tgacggggtc      1680
     aggacttcgg acgatcgtgt tgccggggag atcaaacggg tcactgcggt tttcgggccg      1740
     cacgtgaaat atctacgacc ggaggagccg gtgacgtgcg gtcaggacgg gaagtactgc      1800
     actagcagtc tcgaagtcac ccccaaagta cctaacggag cgatgtcgtc gacggtggcc      1860
     atcgacgacg gtactctgta tgagctgctg actggggaga aggcagacgg cagggtgatg      1920
     aaggctctcg atgatggagt cgtcctgttc tcgcccgatg ccacacggat ttcgcaggcc      1980
     atcatctctg accatgacga acgtcacggt gccggcacca ccgtgcttcc agctatccat      2040
     gctccccacc atgccctggg atacggtgtg cccaatctca tcagccgtag aacggcagcc      2100
     aaggtgcttg gggtaagccc cgacaacatg aaaacccaat ccacaacggt gtggttgcgg      2160
     ttgccgcata ctccgaccgc gagggaaggg gaccgtctgc aacattccct catggacgtc      2220
     accgggtcac cctcggagtt catatgggaa aaggggtact cggatatttc cgggaccgtg      2280
     atgcgctggt cggcggtagt gggcacgctg ttggcggtat gcgtgggcgc cgtggtattg      2340
     gccttgactc tgtccgactc gagggggtcg cgcaccgcca tcgcgtcggt aggggcgtca      2400
     aaggcgacct tgagacgaat ggtggcagca caggccctcg tgacgacagg gcttggtcag      2460
     atccttggct ttctcgtggg gttcgtgccg gttgccgtta tgacgtgcgt cggcccccgc      2520
     tggccgatgc caatgccact gccgtggctg gcgctcatcg tgttcgcccc gccggtgctg      2580
     ctggctttag tgacgatggt cgccgtacca gtgccgcgac cacggatgca gagactggac      2640
     tga                                                                    2643
//

If you have problems or comments...

PBIL Back to PBIL home page