(data stored in ACNUC30630 zone)

EMBL: CP001977.PE249

CP001977.PE249       Location/Qualifiers
FT   CDS_pept        289267..290067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3255"
FT                   /product="HAD hydrolase, family IIB"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99441"
FT                   /db_xref="GOA:D4H9K1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K1"
FT                   /protein_id="ADD99441.1"
FT                   /translation="MLIATDLDGTFLTPDATVSPRNRAAVKAAEAAGIHVIPVTGRAIG
FT                   GLRVIGPVFHRYALVSNGAVGTDMSTGETLFTETMSARTVKSYVDQLTAECPGVVFCAE
FT                   VGDSSVFLVEEGYDEIVPAFESENDPAEHVLVSRKELCSSEAVKLMIVHPTVPASDIYQ
FT                   LSRRLRVPGVHATWAGFTVAEAGPADVTKASGLERICQLLGEDRANVVALGDGANDVEM
FT                   LQWAGVSYAMSGAKPEAIAAADRRAPSCEEDGFAVVVEELLASR"
     gtgctcatcg cgaccgacct cgacggaacc ttcctcaccc ccgacgccac cgtgtctcct        60
     cgaaaccggg ctgccgtgaa ggccgccgag gcagctggta ttcacgtcat tccggtaacg       120
     ggacgggcta ttggtgggct gcgcgtcatc ggtccggtct ttcaccggta tgccctggtg       180
     tctaacggtg ctgtcggtac ggacatgtcc actggcgaga ctctcttcac cgagacgatg       240
     tcggctcgca ccgtgaagtc ctacgtcgac caactcactg ccgagtgtcc gggggtggtg       300
     ttctgtgcgg aggttgggga ttcctcagtc tttctcgttg aggaggggta cgacgagatt       360
     gtccctgcct ttgagtctga gaacgatccc gccgagcacg ttctcgtcag tcgtaaggag       420
     ctgtgctcta gtgaagccgt caagctcatg atcgtgcacc cgacagtgcc tgcctcagat       480
     atctaccagt tgtctaggcg cctgcgggtg cccggagttc acgctacgtg ggcggggttc       540
     acggtggccg aggccggacc ggccgacgtg acgaaggcca gtggtctaga acgcatctgt       600
     cagctcctcg gcgaggatcg tgccaatgtc gtcgctctgg gagacggggc caatgacgtt       660
     gagatgttgc agtgggccgg tgtgtcttac gcgatgagcg gcgccaagcc ggaggcgatt       720
     gctgccgcgg acaggcgcgc tccctcctgc gaagaggatg gtttcgccgt tgttgtcgag       780
     gagttgctgg catctcgata a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page