(data stored in ACNUC30630 zone)

EMBL: CP001977.PE261

CP001977.PE261       Location/Qualifiers
FT   CDS_pept        302187..302360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99459"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L3"
FT                   /protein_id="ADD99459.1"
FT                   /translation="MTRWEYFTAPILVHASQQILNNFGADGWELVQIVAGPNPDSLVGY
FT                   FKRPLPDQEEPR"
     atgacccgat gggagtactt cacagcaccg attctggtgc acgcttcgca gcagatcctc        60
     aataactttg gagccgacgg ttgggaactt gttcagatcg tcgccggccc caaccccgat       120
     tcgctagtgg gctacttcaa acgtccgctg cctgaccagg aggaaccccg atga             174
//

If you have problems or comments...

PBIL Back to PBIL home page