(data stored in ACNUC30630 zone)

EMBL: CP001977.PE269

CP001977.PE269       Location/Qualifiers
FT   CDS_pept        complement(307821..308966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3276"
FT                   /product="methyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00667"
FT                   /db_xref="GOA:D4H9M1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M1"
FT                   /protein_id="ADE00667.1"
FT                   /translation="METAPTPSPTQPCPLLPAMDHSSTKPVTRLRGPLRLPHQPHRWLP
FT                   LTRRPPPIDYPGSPRRPLSPPGQHYAQADAPQRPVLVQESSYLQLSSETAEFVTQCQIC
FT                   GKPCQLADEPLWTTLATTIPSTIGAMAVSSAPHLPSGSFEWLTAGRVDPGSRVVVLCPT
FT                   VAHCRAVASHGADVLAVHRDPDTAEKLNRIPGVMAVCGSPESLPLNSSSFDAVLVHQGF
FT                   HELAPGLALPEIARVLRPGSVLGVSWLVRDDTVPWVKRLAALLRTVDENAMSGDYGTES
FT                   VHELISSKYFPEDEHTTKRLWVPVNRDSLVAMAAARPAVRALDSDARSNVLTKVAALAD
FT                   DSAGTSGLRLPYQLECWRAWVDHDELTTPIRPHDDGLTITL"
     gtggagacag cccccacgcc atcaccgacc cagccatgtc cgctcctacc agcaatggac        60
     cattcctcga ccaagcccgt gacacggctt cgcggccccc taagacttcc acaccaaccc       120
     caccgctggc tgccactgac ccgacgacct ccgccaatcg actatcccgg gtcaccaaga       180
     cgaccgctgt ctcctccggg gcagcactat gcgcaggccg atgcaccgca gcgccccgtc       240
     cttgtccaag aatcttcata ccttcagttg tcgtcggaaa ccgcagaatt cgtcacccaa       300
     tgtcagatct gtggaaaacc gtgccaactc gccgacgagc ccctgtggac aaccctggcc       360
     accacgattc cctctacaat cggggccatg gcagtctctt cggcaccgca tcttcccagc       420
     ggctcattcg aatggctgac tgccggacgt gtggacccag gtagtcgagt cgtcgtgctg       480
     tgcccgaccg tcgcccattg ccgagccgtt gcctcccatg gggccgatgt cctggccgtt       540
     caccgcgatc ccgataccgc ggaaaaactc aaccgcattc ctggcgtcat ggccgtctgc       600
     gggtcgcccg aatcgttacc tcttaattca tccagtttcg atgctgtctt ggtgcaccag       660
     ggctttcacg aattggcccc cggcctcgcc ttacctgaaa tcgcccgcgt cctgcgccca       720
     ggcagtgtcc tcggcgtctc ctggctggta cgcgatgaca ctgttccgtg ggtcaagcgg       780
     cttgcggcgc tactgcgcac cgtcgatgag aatgctatga gcggcgacta cggcaccgag       840
     tcagtacatg aactcatctc cagcaagtac tttccggagg acgagcacac caccaagcgc       900
     ctgtgggtgc cggtcaaccg tgactctctc gtcgccatgg ctgcggcccg accggccgtc       960
     cgggccctcg actccgacgc ccgctccaac gtgctcacga aggttgccgc actcgccgac      1020
     gattctgccg ggactagcgg gttacgtctg ccctatcaac ttgaatgctg gcgggcttgg      1080
     gtcgaccacg atgagctcac cacccctatt cgaccccatg acgacggcct gacgatcacg      1140
     ctctga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page