(data stored in ACNUC30630 zone)

EMBL: CP001977.PE278

CP001977.PE278       Location/Qualifiers
FT   CDS_pept        complement(314162..316462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3285"
FT                   /product="putative DEAH-box helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF09369; match to protein family HMM TIGR03817"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00813"
FT                   /db_xref="GOA:D4H9N0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N0"
FT                   /protein_id="ADE00813.1"
FT                   /translation="MIVPSVSSTRDAVSRLLTSPQVVYLDHREAAAGHTCEWPSWFPED
FT                   CRQAVEAAGIHRPWQHQARFAELARAGRHAAICTATASGKTLAYLLPIMAATASATPVV
FT                   PESPTPGLPASLRDSLHRNSALYLAPTKALAHDQERVCREVGPRDWLVSTLDGDSDEAE
FT                   RRFAREQARYVLTNPDMLHHTVLPSHARWAGLLGSLRYVVIDEAHRYRGVFGAHVAQVI
FT                   RRLRRLCRMHGADPVFLLSSATSTNAAEAGTRLLGVEKVEVVDEDCSPHPGRDVVLWQP
FT                   AESISTDATGLVADLADAGLQTICFVASRSLAEVISAHAQDRVTSGARVTAYRAGYLPE
FT                   DRRRIEARLQDGSVRAVVATNALELGVDISGMDAVVIAGYPGRLSALWQQAGRAGRSGR
FT                   DALVVLMARENPLDQYLFEHPELLFSSSVESTVLHPDNPYVLGPHVAAAAQEAYLSPAD
FT                   EEFYGSAFAGICKTLTGQNVLRRRGNRLFWTRPERAVDAIDLRSAAGKGIDIIDVSTGR
FT                   VIGGVDEAAADRTVHPGAVYLHQGDQWLVDEYNPVEHHALVHQDLPGYWTQPQSASTVR
FT                   ILREERRRACGPGYVACGQVELTEQVVGYLRRDEITNDVWDSVALEMPTHTMITQACWW
FT                   VIPDKVVDDLKFDAVHLAGAAHGAEHTAIGLLPMYSPCDRWDVGGVSTVMLPDTGACTI
FT                   VIHDGQAGGAGFAEAGFEKAEEWWHATIMRLAQCGCESGCPACVVSPKCGNANQMLDKA
FT                   AAAALTAAMDPLA"
     gtgatcgttc catctgtctc gtcaacccgt gacgctgtgt cgcggctgtt gaccagcccc        60
     caggtggtct atcttgatca tcgcgaggcc gcagcaggac acacctgcga gtggccttcg       120
     tggttccccg aggattgtcg tcaagccgtc gaagcggctg ggattcatcg gccatggcaa       180
     caccaggcgc gattcgccga gctggcaaga gcaggccgtc atgcagcgat ctgtaccgca       240
     acggcgtcgg gaaaaacctt ggcctatttg ttgccgatca tggctgcgac ggcatcggcc       300
     accccggtgg tgccggagtc gccaactcct ggcctgccgg catctttgcg ggattcccta       360
     caccgcaaca gtgccctgta cctggctccc acgaaggccc tggctcacga ccaagaacgc       420
     gtttgccgcg aggttgggcc gagggattgg ctggtttcga cccttgacgg cgattccgat       480
     gaggctgagc gtcgtttcgc ccgggagcag gcccgatacg tcctcacgaa cccggacatg       540
     ttgcaccaca cggtgctgcc gtctcatgca cggtgggctg ggttgctcgg aagcctgcga       600
     tatgtcgtca ttgatgaagc ccaccgatat cgcggggtct tcggggcaca cgtggcccag       660
     gttattcgcc ggctgcgcag gctttgtcgg atgcatggcg cagatccggt attcctgctt       720
     tctagcgcga cctcgacgaa cgcagccgaa gccgggaccc gcctgctcgg ggtagagaag       780
     gtcgaggtcg ttgatgagga ttgctcccca cacccgggcc gtgacgtcgt cttgtggcag       840
     ccagccgagt ccatctcaac cgatgcgacg gggcttgtag ctgacctggc cgacgccgga       900
     ttacagacga tctgtttcgt cgcctcgcgt tcgctggcag aggtcatttc tgcccatgcc       960
     caggaccggg taactagcgg cgctcgggtt accgcgtatc gggctgggta ccttcccgag      1020
     gaccgacgac gtatcgaggc cagactgcag gacggctcgg tgcgagcggt cgtcgcaacg      1080
     aatgccctgg agctgggtgt agacatttcg gggatggacg ctgtcgttat cgccgggtat      1140
     ccgggacgac tgtcggcctt gtggcagcag gctggtcgag ccggacggtc gggccgtgac      1200
     gcgttggtgg tgctcatggc ccgggaaaat ccgctggatc aatacctctt tgagcacccc      1260
     gaattattgt tctcgtcctc ggtggaatcg actgtgttgc acccggataa cccgtatgtg      1320
     ctcggcccgc acgtggccgc ggccgcccag gaggcatacc tctcccctgc ggacgaagag      1380
     ttttacgggt cggcctttgc cgggatatgc aaaacgctga caggccagaa cgtactgcga      1440
     cgtcgcggaa atcggctgtt ctggacccgt ccagaacggg ctgtcgacgc catcgacctg      1500
     cgatcggcgg caggcaaagg gattgacatt atcgacgtgt ccacggggag ggtcatcggg      1560
     ggagtcgacg aagccgccgc agaccgtacc gtgcatccag gcgcggtgta cctgcatcag      1620
     ggggatcaat ggctggtcga cgaatacaac ccggtcgagc accacgccct ggtgcaccag      1680
     gacctgccgg gatattggac tcaaccgcag tcagcgtcga cggtgagaat ccttcgggag      1740
     gagagacgtc gcgcttgtgg tcccggatat gtggcgtgcg ggcaggtgga actgacagag      1800
     caagttgttg ggtatctgcg tcgcgacgaa atcaccaatg atgtgtggga ctcggtggcc      1860
     ctcgagatgc ccacccacac catgatcacc caggcctgct ggtgggttat tcccgacaaa      1920
     gttgtggacg acctgaagtt cgatgccgtc catctggcag gggccgccca tggcgctgag      1980
     cacaccgcga ttggactact gccaatgtac tcaccgtgcg accgatggga tgtgggtggg      2040
     gtgtcgacgg tgatgttgcc tgacactgga gcgtgcacca tcgtcatcca cgacggtcag      2100
     gccggtgggg ctggattcgc cgaggccggt ttcgagaagg ccgaggaatg gtggcatgcc      2160
     accatcatgc gcctagccca atgtggatgt gagtctggat gccccgcctg cgtcgtctcg      2220
     cccaaatgcg ggaatgccaa ccaaatgctc gataaggccg ctgctgccgc actgacggca      2280
     gcgatggatc cgctggccta a                                                2301
//

If you have problems or comments...

PBIL Back to PBIL home page