(data stored in ACNUC30630 zone)

EMBL: CP001977.PE286

CP001977.PE286       Location/Qualifiers
FT   CDS_pept        325843..326415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00011"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N8"
FT                   /protein_id="ADE00011.1"
FT                   /translation="MPTCPGKAGDAAVAAAARDRRTRAEILQTVRRTIEDVGVDMEVLA
FT                   IDLVESGDDRAIAVYFRAPHRVEFATIVGPLARRLRARIDLRQLRGRDTARVVGGVGVC
FT                   GRSLCCSTFLPEPSSVPNRLVSEQGMASNPLAVTGACGKLMCCLRYESPYYADFEAALG
FT                   EVRVPDAPRCPLMSTCSRRRDQERKDA"
     ttgccgacgt gccctggtaa ggccggcgat gccgctgtcg ccgctgcagc gcgcgatcga        60
     cgcacccgag ccgagatctt gcagaccgtt cggcgcacca tcgaggatgt gggagtcgac       120
     atggaagtgt tggcgatcga cctcgtcgaa tccggcgatg atcgtgctat cgcggtgtat       180
     ttccgcgccc cacaccgagt ggagtttgcc accatcgttg gtcccctcgc tcggcggcta       240
     cgcgccagaa tcgatttgcg ccagcttcgt ggccgcgata ccgctagggt cgttggtggt       300
     gtcggggtgt gcggtcgttc gctgtgctgt tcgaccttcc tgcctgagcc gtcgtcggtg       360
     ccgaatcgcc ttgtcagcga gcaggggatg gcctctaacc ccttggcggt gactggggca       420
     tgcggcaaac ttatgtgctg cctgcgttac gagtcacctt attacgctga ctttgaggct       480
     gccctcggag aggtcagggt cccggatgct ccgagatgtc cgctaatgtc gacgtgttct       540
     cgcaggcggg accaggagcg caaggacgcc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page