(data stored in ACNUC30630 zone)

EMBL: CP001977.PE290

CP001977.PE290       Location/Qualifiers
FT   CDS_pept        330657..332006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3297"
FT                   /product="amine oxidase (flavin-containing)"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99781"
FT                   /db_xref="GOA:D4H9P2"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P2"
FT                   /protein_id="ADD99781.1"
FT                   /translation="MYDSIIIGAGLAGLTAAEELASAGHSVVVLEARARVGGRLENAEL
FT                   SNGQVVELGGQWVGEGHEELRSLLSSQGLELVDSTDGDVVVKARGRVSHVTSLSEPSAH
FT                   SLSPFELADLGQGLLRFRRLADRVANNKGWAAANATWLNQSLSQWTASNVRTEAGRGYI
FT                   TNLFRQAFGVSANDTPLFNGLAKANAGVDLESLVAVNGGLKQQRVKGGVAQVTRNLAEP
FT                   LGDDLKLSSPVRSVHSDDDGVTVTTTDGTQYQGRSVIVTVPPRLLKDMTFEPALPAERL
FT                   EMADKVPAGNVIKAYLVYDSPWWRTSGASGQMGADEGAVRVIFDTSDDETGKGILMGFF
FT                   EGAEASGYGKLSIGLRQRAFEEVVESAFGKAPSSPIEYLDRDWLAEPYTGGCHGAHFAP
FT                   SLWTTTGPILAEPLGRVLFAGAEYASSFNGYMEGALRAAARAAQEVLDLL"
     atgtacgaca gcatcatcat tggcgcgggt ctagccggac tcacggctgc tgaagagctc        60
     gcctccgcag gacactcggt ggtggtcctg gaggcccgag cccgggtagg cggccgctta       120
     gaaaacgctg agttatccaa cggacaggtc gttgaactgg gtggccagtg ggtgggagaa       180
     gggcatgagg aacttcgctc cctcctctcc tcacaagggt tagaactggt tgattcgacc       240
     gacggcgacg tcgttgtcaa ggccaggggc agggtctctc acgtcacaag tttgtccgag       300
     ccgtccgctc attccctcag ccccttcgaa ttggctgacc tcggccaggg cctgctgagg       360
     ttccgtcgtc tggccgatcg tgttgctaat aacaagggct gggcggcggc taatgccacc       420
     tggttgaacc agtcgttgag ccaatggaca gcctcgaatg ttcgtaccga ggccggtcgt       480
     ggctacatca cgaacctctt ccgtcaagcc ttcggtgtgt ctgccaatga cactcctctc       540
     ttcaacggtc tggctaaggc caacgccggt gtggacttgg aatccctcgt cgccgtcaac       600
     ggtggcctta agcagcagcg cgttaagggc ggggttgctc aggttacccg caacctcgct       660
     gagcctctcg gtgacgatct taaactctcc agcccggtcc gatccgttca tagtgacgac       720
     gacggcgtta ccgtcaccac tactgatggc acgcagtatc agggacgtag cgtcatcgtc       780
     accgtgccgc cgcggctact taaggacatg acattcgagc cagcgctgcc tgctgagcgt       840
     ctcgagatgg ccgacaaggt gccagctggc aatgtcatca aggcctacct cgtttacgac       900
     agcccatggt ggcgcacctc tggtgcttcc ggccagatgg gtgctgacga gggcgctgtc       960
     cgcgtcattt ttgatacctc tgacgacgag accggcaagg gaatcctcat gggcttcttc      1020
     gagggcgccg aggcttccgg ctacgggaaa ctttcgatcg gtctgcgtca acgtgccttt      1080
     gaagaggtcg tcgagtcggc cttcggcaag gcccccagct cgccgatcga gtaccttgat      1140
     cgcgactggc tcgctgagcc ttacaccggc ggatgccacg gagcccactt cgctcccagt      1200
     ttgtggacga ctacggggcc gatccttgcc gagccgctgg gccgggtgct cttcgcgggg      1260
     gctgagtacg cctcttcttt caacggttat atggagggcg cactgcgcgc tgctgctcgc      1320
     gctgctcagg aggtcctcga cctgctctga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page