(data stored in ACNUC30630 zone)

EMBL: CP001977.PE292

CP001977.PE292       Location/Qualifiers
FT   CDS_pept        332485..333336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99242"
FT                   /db_xref="GOA:D4H9P4"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P4"
FT                   /protein_id="ADD99242.1"
FT                   /translation="MQTPSEPVEWQDSMPTQQWQVQDSTPTQQWTTNSQSGPQQPSQGQ
FT                   YRDLGASQMPDDWFRDPEAERTRVMAAVPENPVFTPPPPPSTPAMAYPPPPSGDSSRHR
FT                   KVLIGLVVGLLVLVVLGAVLLFAGGLKGRSGSEPAVVATPSASSQPKQSASEDPQATSI
FT                   DTTPSFLMSSPASPSPVPSSPALSTPTPLSPQSPTLSARQVADKLPDGDTLCSSSVGAV
FT                   GTTSCPFALEVANAIPAGAQGDYEVQAYSPVTGKTYTMKCETQESYTTCTGGIAAKVHI
FT                   LR"
     gtgcaaacgc cgtcggagcc agtggagtgg caggattcca tgccgaccca gcagtggcag        60
     gtccaggact cgacgccaac tcagcagtgg accaccaata gtcagtcggg gccgcagcaa       120
     ccttctcaag ggcaataccg agatcttggg gcttcccaga tgcccgacga ttggttccgt       180
     gacccggagg ctgagcgcac ccgggtgatg gccgcggttc ctgagaatcc cgtgttcacc       240
     cctccgcctc cgccgtcgac gccagctatg gcatatccgc cgccaccttc gggtgactct       300
     tcacgtcatc gcaaagtatt gattggctta gtggtgggtt tgttggtgct ggttgtcctg       360
     ggagctgtgc tgctttttgc cggcggtctc aaagggcgtt cgggtagtga gcctgctgtg       420
     gtcgcgaccc cgtcggccag ctcacagccc aagcagtcag cctcggagga tccgcaggct       480
     acatcgattg acaccacccc gagcttccta atgtcctcgc ctgcctcgcc gagtcccgtt       540
     ccgtcgagtc cagccttgtc aaccccaact ccgttgagcc cgcagtctcc tacattgagc       600
     gctcgtcagg tggctgacaa actgcccgat ggagacaccc tttgttcctc gtcggttggt       660
     gccgtcggta cgacatcgtg cccattcgct cttgaggtgg ctaatgccat accggcgggt       720
     gcccagggcg actatgaggt gcaggcgtat agcccggtga cgggtaagac atacaccatg       780
     aagtgcgaga cgcaggagag ctacaccacc tgtacgggtg gcatcgccgc gaaagttcat       840
     attctgcgct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page