(data stored in ACNUC30630 zone)

EMBL: CP001977.PE305

CP001977.PE305       Location/Qualifiers
FT   CDS_pept        344236..344874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99922"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA39"
FT                   /protein_id="ADD99922.1"
FT                   /translation="MKGRPVFVGCVAVLVLTACGGAGVSAGSHPHTAVASSSVSVVGMS
FT                   APPSASVSVMGSEQAAAVESAAGKAIRDKVKEDGGPIPKEVANVSFHPNLDDNVDVTAH
FT                   VVSIKAGPTGTVLTFWLTSNTIDHAMGPVFPEDFPSLVDTVGGVKYGVNYFSKAGDTSK
FT                   FVVGSEEPEIDAKSVYVMQASYPPLPKSVTKVKIAIGSAKTSPDIPVTR"
     atgaagggtc gtccggtttt cgttggctgt gtggctgtgt tggttttgac ggcttgtggt        60
     ggtgctggtg tgtctgctgg gtcgcatcct catactgctg ttgcttcttc aagtgtgtct       120
     gtggtgggca tgtcggcgcc gccgagtgcg tcggtgagtg tgatgggttc ggagcaggct       180
     gcggctgtgg agtcggcggc gggtaaggcg attcgggata aggtgaaaga ggatggtggc       240
     ccaattccca aagaggtggc taacgtctct ttccatccga acctcgacga taatgtcgac       300
     gtcacagcgc atgtcgtctc gattaaggcg ggccctacgg gcactgtcct gactttctgg       360
     cttacctcga acacaattga tcatgccatg ggtccggtct ttcccgagga tttcccatct       420
     ctcgttgaca ctgttggcgg tgtcaaatac ggggtgaatt acttttccaa ggccggtgat       480
     acgtcaaagt tcgtggttgg tagcgaggaa ccggagattg atgccaagag cgtctatgtt       540
     atgcaggcgt cgtatccgcc tttgccgaag tcggtgacga aggtgaagat cgcgatcggg       600
     tcggccaaaa cgtcgcctga tatcccggtg actcgttga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page