(data stored in ACNUC30630 zone)

EMBL: CP001977.PE306

CP001977.PE306       Location/Qualifiers
FT   CDS_pept        345123..345602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99271"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA40"
FT                   /protein_id="ADD99271.1"
FT                   /translation="MGGLMLGVGLVGCSDSEEGWESVTVDRITVSHPTEWVEKPPENEN
FT                   FTKNFTDGPHGMQIAGHYSDDTEPTLAWSVLEFMIRGTFQGYDPKGYQEITVKGAARAI
FT                   KCPFDFTYKGKSARGYWLVASGVLPTEGSAIVLLRLPRDDTNLVDKIIASMSFKA"
     gtgggcgggt tgatgcttgg cgttgggctg gtgggttgct ctgattcgga ggagggttgg        60
     gaatcagtaa ccgttgatcg catcacggtg agccatccca cggagtgggt ggagaagcca       120
     ccggagaatg aaaatttcac caagaatttc actgacggcc cccatggcat gcagattgcg       180
     ggtcattaca gtgacgacac cgaacctacg ttggcatggt ccgtgcttga attcatgatc       240
     cgcgggacgt tccagggcta cgaccccaag gggtaccagg agatcaccgt caagggcgct       300
     gccagggcga tcaagtgccc gtttgacttc acttataagg ggaaatctgc gcgagggtat       360
     tggcttgttg cttcgggtgt gttgcccaca gagggttccg cgatcgtgct tctccgtctt       420
     ccccgcgatg acacgaatct ggttgacaaa attattgcgt cgatgtcgtt caaggcgtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page