(data stored in ACNUC30630 zone)

EMBL: CP001977.PE31

CP001977.PE31        Location/Qualifiers
FT   CDS_pept        30168..30389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3031"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99020"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI9"
FT                   /protein_id="ADD99020.1"
FT                   /translation="MEVTVGCRLAMLDVLEGDQEWWVDGGCAESGERESPRRVGDDAPR
FT                   DAVGVEPDEEFPAADRRLYAVELCALLV"
     atggaggtaa ccgtcgggtg ccggcttgcc atgctcgacg tcctcgaggg tgaccaggag        60
     tggtgggtcg atggtggctg cgccgagtcg ggcgagcgcg agtcgccgcg gcgcgttggt       120
     gacgacgccc cacgggatgc ggtgggcgtc gagccagatg aggagttccc agccgccgac       180
     cgcaggcttt acgctgtcga gctgtgtgca ctcctggtct ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page