(data stored in ACNUC30630 zone)

EMBL: CP001977.PE327

CP001977.PE327       Location/Qualifiers
FT   CDS_pept        complement(364245..364763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00305"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ4"
FT                   /protein_id="ADE00305.1"
FT                   /translation="MLIDANRFDLLEELILAEPLRHGQPVVLIDGRSGAGKTTLANTLI
FT                   CHHADWQLVHADDLYPGWSGLSAVWDLRDLVARRRYRRWDWYQNRFDDEVILNANRPLV
FT                   IEGCGVLTPTNAPLASLRVWCEVSAPLRRHRALARDPEFRDQWAMWAVQEGLHIARHRP
FT                   ADLADLTIS"
     gtgctcattg acgccaaccg cttcgacctt ctggaagaac tcatccttgc cgaaccttta        60
     cgacacgggc agccggttgt cctcatcgat gggcgctctg gagcaggcaa aactacctta       120
     gccaataccc tcatctgtca ccatgccgac tggcagctcg tccacgctga cgacctgtac       180
     cccggctggt ccggattgtc agcagtgtgg gatctgcgtg atctcgtcgc tagacgccgg       240
     taccggcgat gggactggta tcaaaaccgc ttcgacgacg aagtcatcct gaatgcgaat       300
     cgtcccctcg ttatcgaggg ctgcggggta ctgacgccga cgaatgcacc tttggcatcc       360
     ttgcgagtgt ggtgcgaagt ctccgcaccg ctcaggcgcc accgggccct agcccgggac       420
     ccagaatttc gcgaccagtg ggccatgtgg gccgttcagg aggggctaca catcgcacgt       480
     caccgaccag ctgatctcgc cgatctcacc atttcctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page