(data stored in ACNUC30630 zone)

EMBL: CP001977.PE328

CP001977.PE328       Location/Qualifiers
FT   CDS_pept        complement(364873..365529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3335"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF04967; match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00883"
FT                   /db_xref="GOA:D4HAJ5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ5"
FT                   /protein_id="ADE00883.1"
FT                   /translation="MLPVRVLLVDDDTLVRRAVRQILEAADDLEVVGEASDGDGAVRQA
FT                   PQADVVLMDLRMPGMSGVEATSRITHSPSSPKVVVLTTVTADAAITDAVHAGASGFLLK
FT                   ASSPDDIVNAVRAVHAGDAFMSPTSTRQLLEQLRGDAGRRVRGAARKTLSALTDREREV
FT                   AIAVAEGLTNDAIAARLNVSASTVKAHLSTIQTKLDVDSRVRIAVLVERAGYLAA"
     atgctgcccg ttcgcgtctt actcgtcgac gacgacacgc tcgtacgcag ggctgtgcgc        60
     cagatccttg aggccgctga tgaccttgag gtggtcggtg aggccagtga cggcgacgga       120
     gccgtgaggc aggctcccca ggccgatgtg gtcctcatgg acctgcgaat gcccggaatg       180
     agtggtgtgg aagcaacatc gcgaatcacc cattccccga gttcacccaa ggtcgtcgtc       240
     ctcactaccg tcaccgccga cgcggccatc accgacgcgg ttcacgccgg ggcatcgggg       300
     ttcctactga aagcctcctc acctgatgac atcgtcaatg ccgtgcgtgc ggtccacgct       360
     ggggatgcct tcatgtcccc gacgtcgacc cgccaacttc tggaacagtt gcggggcgac       420
     gctggtagac gggtccgcgg ggctgcccgc aagacccttt ccgccctcac tgaccgggag       480
     cgagaggttg caatagcggt ggccgaggga ctaaccaatg acgccatcgc cgcgcggtta       540
     aacgtttcgg caagcaccgt caaggcgcat ctgtcgacga ttcagaccaa gctcgacgtc       600
     gacagtcgag tccgcatcgc ggtactcgtt gagcgggctg ggtatcttgc tgcataa          657
//

If you have problems or comments...

PBIL Back to PBIL home page