(data stored in ACNUC30630 zone)

EMBL: CP001977.PE34

CP001977.PE34        Location/Qualifiers
FT   CDS_pept        complement(32118..32855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00036"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ2"
FT                   /protein_id="ADE00036.1"
FT                   /translation="MVKEQRPCIIGTVAISTTLHLAPNDIGAFTDTDELRILMESAESH
FT                   GYFDPPPLENREYLIERPIGVVVSDTSQPEYLTLRLDCNPERHILGRPGMKIMLVLADA
FT                   LRLIGLSTPQSIDVECVYFDPRDWDLLNPDPEDHIHMIGTLSREVCRWMSPHLTHTWHT
FT                   TATTNPDLDPHLAQNTINRWFPPDFEYPWLGHTPQAHQETLTWHMPDDITALGWLFDLI
FT                   TLLQGQPPQHIHATPNEQKIRPW"
     atggtaaaag aacaacgccc atgcatcatc ggcaccgtag ccatcagcac aacgctccac        60
     ctcgcaccca acgacatcgg agcattcacc gacaccgatg aactacgcat cctcatggaa       120
     tcagccgaat cccacggcta cttcgaccca cccccactag aaaaccggga atacctcata       180
     gaaagaccca tcggagtagt cgtatccgac accagccaac ccgaatacct caccctacgc       240
     ctagactgca atcctgaacg ccacatcctc ggacgacccg gcatgaaaat catgctcgtc       300
     ctcgccgacg ccctccgact catagggtta tccacccccc aaagcatcga cgtcgaatgc       360
     gtctatttcg acccccgcga ctgggatctc ctcaacccag accccgagga ccacatacat       420
     atgatcggta ctctcagccg cgaggtctgc cgatggatgt ctcctcacct cacccacacc       480
     tggcacacca ccgccaccac caaccccgac ctcgaccctc acctagcaca aaacaccatc       540
     aaccgctggt tcccaccaga cttcgaatac ccctggctag gacacacacc ccaagcccac       600
     caagaaaccc tcacctggca catgcccgac gacatcacag cgctaggctg gctattcgac       660
     ctcatcaccc tcctccaagg ccaaccacca caacacatcc acgccacccc aaacgaacaa       720
     aaaatccgac cctggtga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page