(data stored in ACNUC30630 zone)

EMBL: CP001977.PE350

CP001977.PE350       Location/Qualifiers
FT   CDS_pept        388841..389728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3357"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99871"
FT                   /db_xref="GOA:D4HAL7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL7"
FT                   /protein_id="ADD99871.1"
FT                   /translation="MPDCFGLSETTTTSASVAPRVTLSTTSVYPESTADAFARAKAIGY
FT                   DGVELMVGIDPVAADVDRIVDLSAEYGVTVSSIHAPCLLVTPNVWGSDPWGKLDNAAEA
FT                   AGRLGSKLIVVHPPFRWQRDYAGRFEEGIAKFNEKYFPLVFAVENMYPWRTPAGRFAAY
FT                   SPGFDPTNLSYDHLVLDLSHAATAQMNSRTLVDLWGSRLRHIHLTDGSGTFKDEHLLPG
FT                   QGNQHAWEVIERAVTGGFDGDIVLEVNTRKFSGEGAGQGARFEALSETLTQTRLAIDRG
FT                   IFARRSGQAWEGAR"
     gtgcctgact gtttcggact ttctgaaacg acgaccacgt ctgcctcagt cgccccccgt        60
     gtgacgttgt cgacgacctc ggtctaccct gagtcgaccg ccgacgcttt cgctcgcgct       120
     aaggctatcg gttatgacgg agtcgagttg atggtcggta tcgatccagt cgccgcagac       180
     gttgaccgga tcgtcgattt gtcggctgag tatggcgtca cagtgtcgtc gatccatgcg       240
     ccgtgtctgc tcgttacgcc aaatgtgtgg ggtagtgacc cgtggggcaa gttggataac       300
     gccgccgaag ctgctggacg gctcggctcc aagctcattg tcgttcaccc tcccttccgc       360
     tggcagcgtg actatgcggg tagatttgaa gaaggtattg ccaaattcaa cgagaagtac       420
     ttcccgctcg tctttgccgt agaaaacatg tatccgtggc gtactccagc gggtcgcttt       480
     gctgcttatt cgccggggtt tgaccccaca aacctcagtt acgaccacct cgtcttggac       540
     ctctctcacg ccgcaaccgc ccagatgaac tctcgtaccc tggttgatct gtggggttca       600
     cgattgcgtc acatccacct gacggacggc tctggtacct ttaaggacga gcatctttta       660
     cccggccagg gaaaccagca tgcctgggag gtcatcgagc gagcggtaac gggtggattt       720
     gacggggaca ttgtgttaga ggtcaacact cgtaagttct ctggcgaggg tgcgggccaa       780
     ggtgctcgct tcgaagcatt gtctgaaact ctgacgcaga ccaggttggc gattgatcgt       840
     ggcatctttg ctcgccgatc tggccaggcg tgggaagggg cccggtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page