(data stored in ACNUC30630 zone)

EMBL: CP001977.PE361

CP001977.PE361       Location/Qualifiers
FT   CDS_pept        397899..399488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3368"
FT                   /product="ResB-like protein"
FT                   /note="identified by match to protein family HMM PF05140"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99754"
FT                   /db_xref="GOA:D4HAM8"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM8"
FT                   /protein_id="ADD99754.1"
FT                   /translation="MGDSVTDSKVTTASPSGNSGLGFRPFMRWVWGQLTSMRTALILLF
FT                   LLALAAIPGSVVPQSAQSAMKVSDFAANHPTLDRICRPLGMYHVYTSVWFSAIYLLLLI
FT                   SLIGCIVPRIVSHAKALRRQPPRVPARLDRLAAHASMITSASAAEVSQRAQQWLTSHRY
FT                   RFVVDDDGSLRAEAGRHRETGNLVFHIFLVFVLVGVGWNTLWGFKGTSVVVEGQGFSNS
FT                   ITQYDEFKAGAMVDTDNLTPFSMKLRKFVVSFETGTVQRGAARSFDATVDLTMGGKTQT
FT                   RDLQVNHPLRIGSTKVHLLGHGYAADVVVRDGDGKVAYSGPVVFLPQDANFKSVGVIKV
FT                   PDARPDRLAFQGFFLPTGAITAGGPTSLFPDALNPQLYLTAWYGKPTVETGVPSNIYTL
FT                   DTTGLTQVTNGKDKARFVLSPGQRYKLPDGKGSIQFNGWQRWAKIQVSQNPGLPLTFLS
FT                   VVLSVAGLCVSLFSRSRRVWVRTIPGDDGLRVEIGGLDRSDSRSGAVDDVNSLLAALHG
FT                   DSMSGDVGEEHS"
     atgggcgatt ccgtgacgga ttcgaaagtg acgacggcct caccgtctgg gaacagcggg        60
     ctgggttttc gcccattcat gcgttgggtg tggggccagt tgacgagcat gaggacggcc       120
     ctcattttgc tctttttgct tgcgctagct gccatcccag gctcggtggt gccgcagagc       180
     gctcagagcg cgatgaaggt ttctgacttc gccgccaacc atccgactct ggaccgcata       240
     tgtcgtccgc tggggatgta ccacgtctac acctcggtgt ggttctcggc gatctacctc       300
     ctgttgttga taagccttat cggctgcatt gttccgcgca tcgtcagcca cgcgaaggct       360
     ctgcgccgtc aacctccccg cgttccggcc aggctggacc ggctagcagc ccacgcctcg       420
     atgatcacct ccgcttccgc agcggaggtt agtcaacgcg ctcagcagtg gttgacatca       480
     caccggtatc ggttcgttgt tgacgacgac ggctcccttc gcgccgaggc cggacgtcat       540
     cgcgagacgg gcaacctcgt attccatatt ttcttggtct ttgtccttgt tggcgtcggc       600
     tggaacactt tatgggggtt caagggaact tctgtcgttg tggagggtca gggtttttct       660
     aacagcatca ctcagtacga cgaattcaag gctggggcga tggtcgatac cgataatctc       720
     accccgtttt ccatgaagct gcgcaaattc gtggtctctt ttgagactgg tacggtgcag       780
     cgcggcgccg cccgttcctt cgacgccact gtcgacctca ccatgggcgg caagacgcag       840
     acccgagatt tgcaggtcaa ccacccactg cggattggat caacaaaggt acacctgctt       900
     gggcacggat acgccgcgga tgtcgtcgtc cgtgacggtg atggcaaggt ggcttattcc       960
     ggaccggttg tctttttgcc acaggacgcc aacttcaagt ctgtcggcgt catcaaagtt      1020
     cccgacgccc gtccggatcg tctggccttt caagggttct ttctaccgac tggcgccatc      1080
     acggccggtg gtccgacgtc ccttttcccc gacgccctta acccgcagct gtatctgacc      1140
     gcctggtatg gcaaaccgac tgtggagacg ggggtgccgt caaatattta caccctcgac      1200
     accacgggac tgacccaggt gacgaacggt aaggacaagg cccgctttgt gctatcccca      1260
     ggtcagaggt acaaactgcc cgacggcaag gggtcgatcc agttcaatgg ctggcagagg      1320
     tgggccaaga tccaggtgtc ccagaacccg gggctcccgt tgacgttctt gtcggtggtg      1380
     ctgtcagtgg cagggctatg tgtgagcttg ttttcgcggt cccggcgggt gtgggtgagg      1440
     actattcctg gtgatgacgg cttgagagta gagattggtg gcctagatcg cagtgactcc      1500
     cgatccgggg ctgtggacga cgtaaactct ctgctggctg cactacatgg ggatagcatg      1560
     tctggcgatg tcggggagga gcactcgtga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page