(data stored in ACNUC30630 zone)

EMBL: CP001977.PE383

CP001977.PE383       Location/Qualifiers
FT   CDS_pept        421727..423112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3391"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /note="identified by match to protein family HMM PF02397;
FT                   match to protein family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00827"
FT                   /db_xref="GOA:D4HAQ0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAQ0"
FT                   /protein_id="ADE00827.1"
FT                   /translation="MKKDYFNRTQKLVTVLIDAIVFVVGIFLSFWMRFGMVIPQRNLDD
FT                   GKAALMTSVIAFLIINVLSGVYVLYNKTLLDIGIITVVDQVMVTIVIMALTFFGRWFAF
FT                   PRSVLLINLVVGIVLLLVWRSVEVVAYRHLRGAKRVMLLGPPEMLNRAVMNYMANKATR
FT                   HRLTHVVRGHYLEQIRSHINEFDTAHVSDDIPSSERVAIYDLLLSEDKEIFMSTSFEHM
FT                   MLINPTIMSIEDETIIAASPFKIPAEMDIVKRFFDILLSLIALVVASPIMFVTAILVKA
FT                   SSPGPVFYRQTRITKDGREFKILKFRSMGVMAEKESGPMLATTNDPRVTTVGKYLRSLR
FT                   IDEIPQLINVLIGDMSIVGPRPERPFFVDQFQEQNAHYTLRHNVRAGITGYAQVYGKYA
FT                   SDFAAKLNFDLIYIKQYSLVLDVKIMIQTIKILFDKVSSRGVDETAEPDENIHLPAEVQ
FT                   QLN"
     gtgaagaagg attatttcaa ccgcacccag aaattggtga cggtcctcat tgacgccatc        60
     gtctttgtgg tcggcatctt tttgtcattc tggatgcgtt tcggaatggt cattccgcag       120
     cgaaatctag atgacggaaa agccgcgctc atgacgtcgg ttattgcgtt ccttattatc       180
     aatgtcttgt ctggtgttta cgtcctgtat aacaagacat tgttagatat aggaattatc       240
     acggttgtcg accaggtcat ggtgactatc gtgattatgg cgttgacctt ctttgggcga       300
     tggtttgcct tcccgcggtc ggtccttctc atcaacttgg tggtcggcat cgtcttgctc       360
     cttgtgtggc gcagtgtcga ggtcgtagcc tatcgccatc tacgaggggc taagcgggtg       420
     atgttgctcg gtcctcctga gatgcttaac cgggccgtca tgaactacat ggcgaataag       480
     gcgacccgtc atcgccttac tcatgtggtg cgtggccact acttggagca gattcgatct       540
     catatcaacg agtttgatac tgcccacgtt tctgacgata ttccttcctc tgagcgagtc       600
     gctatttatg atctgctgct gagtgaggat aaggaaatct tcatgtccac ctcgtttgag       660
     catatgatgc tcatcaatcc gacaataatg tcgattgaag atgagacgat cattgctgcg       720
     agcccattta agattccggc agaaatggat attgtcaaga ggttctttga cattttactg       780
     tcgctaatcg ccctggttgt cgcgtcgcca attatgttcg tcaccgcgat cctggtgaaa       840
     gccagctctc ccggtccggt tttctaccgt cagacccgca tcactaagga cgggcgcgag       900
     ttcaagatcc tcaaattccg ttctatgggt gtgatggccg aaaaagagtc cggccccatg       960
     ttggccacta ccaacgaccc gcgcgtgacc acggtgggca aatacttgcg tagcttgcgc      1020
     atcgacgaga tcccgcagct cattaacgtg ctcatcggcg acatgtcgat cgtcggtcct      1080
     cgccccgaac gacccttctt cgtcgaccag ttccaagagc agaacgccca ctacacattg      1140
     cggcacaacg tgcgcgctgg catcaccggg tacgcgcagg tctacggtaa atacgcttca      1200
     gacttcgccg ccaaactcaa cttcgatctt atttacatca agcagtactc acttgttctg      1260
     gacgtcaaga tcatgatcca gaccatcaag atcctcttcg acaaggtctc ttcgcgaggt      1320
     gttgacgaga cagctgagcc cgacgagaac atccacctgc ccgcggaggt ccagcagctg      1380
     aactga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page