(data stored in ACNUC30630 zone)

EMBL: CP001977.PE390

CP001977.PE390       Location/Qualifiers
FT   CDS_pept        complement(428208..428693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3398"
FT                   /product="CarD-like protein"
FT                   /note="identified by match to protein family HMM PF02559"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99827"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB38"
FT                   /protein_id="ADD99827.1"
FT                   /translation="MTFNVGETVVYPNHGAAVIEDIETRTIKGEEKLYLVLRILGQNDL
FT                   VVRVPASNLDLVGVRDVVDDEGLENVFEVLRKTNVEEPSNWSRRYKANLEKLHSGNVLK
FT                   VAEVVRDLWRRERDRGLSAGEKRMLSKARQILVSELALAKKVADDRAEEMLDEVLAS"
     atgactttca acgttggtga aaccgttgtc tacccgaatc atggcgctgc cgtgatcgag        60
     gatatcgaga ctcgcactat taaaggtgag gaaaagctct acctcgttct gaggattctc       120
     ggacaaaacg atttggttgt gcgagtgcca gccagcaatc ttgaccttgt cggcgttcgt       180
     gacgtcgttg atgacgaggg tctcgagaat gttttcgagg tccttcgtaa gaccaatgtt       240
     gaggagccat ccaactggtc tcgccgttac aaggctaacc ttgaaaagct ccactctggc       300
     aacgttctca aagttgccga ggtcgtccgt gacctgtggc gccgcgaacg tgaccgcggt       360
     ctgtccgccg gcgagaagcg gatgctctcg aaagctcgtc aaatcctggt gtctgagtta       420
     gccctcgcca aaaaggtagc tgatgaccgg gctgaggaga tgctcgacga ggttctcgcc       480
     tcctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page