(data stored in ACNUC30630 zone)

EMBL: CP001977.PE401

CP001977.PE401       Location/Qualifiers
FT   CDS_pept        complement(436559..438007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3409"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99422"
FT                   /db_xref="GOA:D4HB49"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB49"
FT                   /protein_id="ADD99422.1"
FT                   /translation="MQEGDSVTPHTSTTVDKGDAGYDKALKNRHLQMIAIGGSIGTGLF
FT                   LGTGGRLAQGGPGLAISYAVCGIFAFLMVRALGEMAIRRPSSGAFVSYAREFMGEKGAY
FT                   ATGWFFFLDWSVTVMADITAVALYLHYWTPLRAIPQWVLALIALGVVFTLNMLSVKMFG
FT                   EAEFWFAAIKVAAIILFMIAAIWAIVTGARVGNYTAGLHNIAQHGGFFPAGLAPVFALT
FT                   LGVIFAFGGTEMVGVAAGETKDASKILPKAINSMILRIFVFYVGSIILMALVLPYTAYS
FT                   SNESPFVTFFTGIGIPYAGDIIQVIVLTAALSSLNAGLYSTGRTLRSLAVAGEAPKAAA
FT                   KLNRHHVPSGGIAMTAALGLLGVALNAFLPDSAFEIVMNLAGIGIAGTWAMVLLAHTRF
FT                   VSAVRRGKDNRPEYRMPGAPVTNYISLAFLLIVVLSNVTSESGRWTLALFALVAIAMVA
FT                   GWYAVRNSIKPDLLDNVVPSDEGM"
     atgcaggaag gtgattctgt caccccgcac accagcacca ccgttgataa gggggatgcc        60
     ggctacgaca aggccttaaa gaacaggcac ctgcagatga tcgccatcgg cggctcaatc       120
     ggcaccggct tgtttctggg tactggcgga cgccttgccc aaggtggccc cggattggcg       180
     ataagctacg ccgtctgtgg catcttcgcc ttcctcatgg tgagggccct cggtgagatg       240
     gctattcgtc gtccgtcctc aggcgccttc gtgtcctacg cgcgtgaatt catgggtgag       300
     aagggcgcct acgccaccgg atggttcttc ttccttgact ggtcggtcac ggtgatggct       360
     gacatcaccg cagtggcgct gtacctgcat tattggacgc ccttgcgtgc catcccacaa       420
     tgggtgttag cgctcatcgc cctcggcgtg gtgtttaccc tcaacatgtt gagcgtgaag       480
     atgttcggcg aggccgaatt ttggttcgct gctatcaagg tagccgcgat catcctgttc       540
     atgatcgcgg ccatctgggc catcgtcacg ggtgcgcggg ttggcaacta caccgcaggc       600
     cttcacaaca tcgcccagca tggcggattc ttccccgctg ggctggcgcc ggtctttgca       660
     ctcactctgg gagtgatctt cgccttcggc ggcaccgaga tggtcggcgt agcagcaggc       720
     gagaccaagg atgcgagcaa gatcttgccc aaggccatca actcgatgat cctgcgtatc       780
     ttcgtcttct acgtcggttc gatcatcttg atggcgctgg tactgccgta cactgcctat       840
     tcaagcaatg aatccccgtt cgtcaccttc ttcaccggaa tcggaattcc ctacgctggt       900
     gacatcatcc aggtaatcgt cctgacggct gccctcagct cgctcaatgc tggcctgtac       960
     tcgaccggac gcaccctgag gtcattggcg gttgccggcg aagcaccaaa agccgctgct      1020
     aaactcaacc gtcaccacgt gccttctggc ggcatcgcca tgaccgccgc cctcggtctg      1080
     ctgggcgttg ccctcaacgc cttcctcccg gatagcgcct tcgagatcgt catgaacctc      1140
     gccggcatcg gtatcgccgg cacgtgggcg atggtcctgc tcgcccacac ccgtttcgtg      1200
     agcgcagtga ggcggggcaa ggacaaccga ccggaatacc gcatgcctgg tgccccggtc      1260
     acgaactaca tctcattggc cttcctgctg atcgtcgtac tgtcgaacgt cacttcggaa      1320
     tcggggcgct ggacactagc cctcttcgcc ctggtcgcaa ttgccatggt cgccgggtgg      1380
     tacgcagtcc gtaacagcat caaacccgac ctgctcgaca acgtggttcc aagcgatgag      1440
     gggatgtga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page