(data stored in ACNUC30630 zone)

EMBL: CP001977.PE413

CP001977.PE413       Location/Qualifiers
FT   CDS_pept        complement(450773..452191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01136"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB61"
FT                   /protein_id="ADE01136.1"
FT                   /translation="MGGKLFLVTRFLSAKPDSRLLPLPWSTPLAQWPQERLVALPRGIS
FT                   RHVVRFITVDDDVYAAKEVVEHLAIHEYRLLHDLMRLDTPSVEPIGVITDRVASNGEPL
FT                   EPIILTRHLRFSLPYRSLFHSGVRQGTVMRLLDALVVLLVRLHLVGFLWGDISLSNVLF
FT                   RRDAEAFAAYLVDAETGELHDHLTTGQREHDLQIARTNLYGEFLDLEEGDMLDDALDPL
FT                   GLVTTIEDRYHDLWNELTAAEEFDGGDYSQVESRVRRLNALGFDVAELDIQTSPDGQRL
FT                   RIQPKVVDAGHHQRRLLRLTGLDTEEFQARRLLNDLDTFRARNGLQGVDEAVAAHRWLT
FT                   ECFEPVVQQIPPELSRKRELAQFYHEVLDYRWYESQRQQREVPHVEAAQGYVRDILAKL
FT                   PDEAISTESVVPVDGSPAHSGHELVNVYDPSLGYVEDEEEDAPYDPWEAHAEAIDVESA
FT                   SRLDIDALRARMKR"
     gtgggtggca aactgttcct cgtgacccga ttcctcagcg cgaagcccga ctcccgcctg        60
     cttccgttgc cgtggagcac accgttggca cagtggccgc aggagcggct cgtcgcgctg       120
     cctcggggca tctctcgtca cgtggtgcgg ttcatcactg tcgacgacga tgtctacgcc       180
     gccaaggagg tcgtcgagca cctcgcaatt cacgaatacc gcttgctgca cgacctcatg       240
     aggctcgata ccccgtcggt cgagcccatc ggcgtcatta ctgaccgcgt tgcgtccaac       300
     ggtgaaccgc tggagccgat catcctcacc cgccacctac ggttctcttt gccctacagg       360
     tcccttttcc attctggtgt gcgtcaagga accgtcatgc ggctccttga cgccctcgtc       420
     gttcttcttg tgcgacttca tctggtgggc ttcttatggg gtgacatctc gctgtcgaac       480
     gtactgttcc gacgagatgc cgaggccttc gcggcctatc tagtcgatgc cgagaccggt       540
     gagctgcacg atcacctgac caccggccag cgggaacacg acctacaaat cgcccggacg       600
     aatctctatg gcgagttcct cgaccttgaa gagggcgaca tgctcgacga tgccctggac       660
     cccctgggct tggtcacgac tatcgaggac cgctatcacg acctgtggaa tgaactcact       720
     gcggccgagg aattcgacgg aggcgattac tcccaggtcg agtcgcgggt acgtcgcctc       780
     aatgctcttg gcttcgacgt cgccgaattg gacatccaaa cctcgccgga cggccagcga       840
     ctacgcatcc agcccaaggt cgttgacgcc gggcaccacc agcgtcgctt gctgcgccta       900
     actggcttag acaccgaaga attccaggca cggcgtctgc tcaacgatct cgacactttc       960
     cgggcgcgca atgggcttca gggggttgac gaggcagtcg cggctcaccg ctggctcacc      1020
     gagtgtttcg agccagtcgt ccagcaaatt ccgccggaac tgtcccggaa acgcgagctc      1080
     gcgcagtttt accacgaggt cctcgactat cggtggtacg agtctcagcg tcagcaacgg      1140
     gaagtccccc acgttgaagc agcccagggc tacgtccgtg acattctcgc caagttgccc      1200
     gacgaggcca taagcacaga atccgtagta ccggtggacg gttcaccggc gcacagcgga      1260
     catgaactgg tcaacgtcta cgacccgtcg ctcggatacg ttgaggacga agaggaggac      1320
     gctccctacg acccgtggga ggcccatgcc gaagctatcg acgtggagtc tgcgtcacgt      1380
     ctcgacatcg acgccttacg agcccgaatg aaacgctag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page