(data stored in ACNUC30630 zone)

EMBL: CP001977.PE417

CP001977.PE417       Location/Qualifiers
FT   CDS_pept        453573..454127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00706"
FT                   /db_xref="GOA:D4HB65"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB65"
FT                   /protein_id="ADE00706.1"
FT                   /translation="MSKQYVSPPLIRRPSRTLPVTILAVVLLAAGVVAIIAAIQRLQHG
FT                   SLPQWVAWGRGHMTTASWLNDTALTVAIVIGVVALLFLIWAFKPGRTSGVFLQPSEGAP
FT                   DNREIVMDNSDLTGWLSRWLDEEDGVASSVVKRRGKTLKVHAETDVKDPEVMREQLTTR
FT                   IAARVDSLGLEQPLKVEVRLR"
     atgagcaagc agtacgtgtc tcctcctctc attcgtcgac cctcccggac gcttccggtg        60
     acgatcctgg ctgtcgtgct cctggcagcc ggggtggtgg ccatcatcgc tgctatccaa       120
     cgactccagc acggatcctt gccgcagtgg gtggcctggg ggcgtggtca catgaccacc       180
     gcgtcatggc tcaacgacac tgccctgaca gtggccattg ttatcggtgt cgtcgcgctg       240
     ctgtttctga tatgggcctt caagccggga cggacatctg gggtgtttct tcaaccgagc       300
     gagggtgctc ctgacaatcg ggagatcgtc atggacaact cggacctgac agggtggctg       360
     tctcgctggc ttgacgagga ggacggcgtc gcatcatcag tagtaaaacg tcgtggcaaa       420
     actctcaagg tccacgccga gactgacgtc aaggacccag aggtgatgcg ggagcagctc       480
     acgacgagaa tcgctgcccg cgttgattcg ctggggttgg aacaacccct gaaggtggaa       540
     gtgaggttgc gatga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page