(data stored in ACNUC30630 zone)

EMBL: CP001977.PE420

CP001977.PE420       Location/Qualifiers
FT   CDS_pept        455565..455987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99252"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB68"
FT                   /protein_id="ADD99252.1"
FT                   /translation="MRIEALRADQLRDDTVAEDAQTKVVVDPLKLSSVWRSYAADLSPR
FT                   HCVFDDDGGQVEVRETVLAAIVRNSLADCEDGRLNRIRFSVPHTPLRLRIDLSVARGVR
FT                   IPDCAERVRHRISTAMTRELGGRPEAIDIIVEDIHV"
     gtgcgcattg aggctcttcg tgctgatcag ctgcgtgacg acacggttgc tgaggatgcg        60
     cagaccaagg tagtcgtcga tccactgaag ctaagctcag tgtggaggtc atacgctgct       120
     gacctctcgc cgcgccactg tgttttcgat gatgacggcg gtcaagtgga agtccgagaa       180
     accgtgcttg ccgcgattgt gcgtaacagc cttgccgact gcgaggacgg gagacttaat       240
     cggattcggt tctcggtgcc ccacacccca ttgagacttc gcattgattt atctgtcgcg       300
     cgaggggtgc ggatacctga ttgtgccgag cgggtgcgtc accgcatttc gacggcgatg       360
     acccgtgagc ttggtggccg tccggaagcg atcgacatca tcgtggagga tatccatgtc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page