(data stored in ACNUC30630 zone)

EMBL: CP001977.PE433

CP001977.PE433       Location/Qualifiers
FT   CDS_pept        complement(470309..471145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3441"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00107"
FT                   /db_xref="GOA:D4HB81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB81"
FT                   /protein_id="ADE00107.1"
FT                   /translation="MIRFDHVSKRFDDGTVAVDNFELTVESHHLVVLLGSSGCGKTTLL
FT                   RMVNRMVDPSEGRILIDDTDVATVNPVKLRRQIGYVMQSGGLLPHRTVVDNIAAVPLLS
FT                   GVSRTAARTRAMDLLERVGLDSSLARRYPTQLSGGQRQRVGVARALAANPDILLMDEPF
FT                   GAVDPVVRTELQQGLLQIQADLAKTIVFVTHDVDEAFLLGDEVLVLRREAQVAQRGRPD
FT                   DVLLHPIDDFVSSFIGGDRRNLHMERHDDHPTIVDAGGRLVGRFANQPSTTVRENS"
     atgatccgtt tcgaccacgt cagcaaacgt ttcgatgacg gaacagtcgc cgtcgacaac        60
     ttcgaactga cagtggaatc acaccacctg gtggtcctcc tggggtcttc ggggtgtggc       120
     aagacgaccc tgctgcggat ggtcaatcgg atggttgatc catctgaagg acgaatactc       180
     atcgacgaca ctgatgtcgc caccgtcaat ccggtcaagc tgcgccgcca gatcggatac       240
     gtcatgcaat cgggcggatt gctcccccac cgcactgttg ttgacaacat cgccgctgtg       300
     ccccttctct cgggggtttc gcggactgct gcccgtaccc gagcgatgga cttactcgaa       360
     agagtcggcc tcgattcttc cttggcgcgt cgatacccca cccaactatc aggcgggcag       420
     cgacaacgag tcggggtggc acgcgccctg gccgccaacc ccgacatcct cctcatggac       480
     gagcctttcg gtgctgtcga cccggtggtg cggaccgagt tacagcaggg tctgctgcaa       540
     atccaggcgg atctagcaaa gacgatcgtc ttcgtcaccc atgacgttga cgaggcattc       600
     ctgctcggcg acgaggtgct tgtcttgcgg cgggaagccc aggtcgcgca acgagggcga       660
     cccgacgacg tcctcctcca tccgattgac gacttcgtct cctccttcat tggtggcgat       720
     cgccggaacc ttcacatgga gcgacatgat gaccacccca ccatcgttga tgccggtggt       780
     cgactcgtgg ggcgtttcgc caaccagcca tcgacaaccg tccgggagaa ttcgtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page