(data stored in ACNUC30630 zone)

EMBL: CP001977.PE435

CP001977.PE435       Location/Qualifiers
FT   CDS_pept        472111..472482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3443"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04343"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00470"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB83"
FT                   /protein_id="ADE00470.1"
FT                   /translation="MEDMTIFRAVNIRDDLKKGPAEGYRVLVDRMWPRGVKKDDARLDE
FT                   RRTDLAPSSQLRTWWNHDPERFDEFAGRYEVELDESGAAKTFLEECAGRDEVILLYGAG
FT                   DREVNHAVVLERILTELAN"
     gtggaagaca tgacgatttt ccgcgcagtg aacattcgtg atgacctcaa gaagggccct        60
     gccgaggggt accgggtatt ggttgatcgg atgtggccgc gaggggtcaa gaaggatgac       120
     gctcgactcg acgagcggcg caccgatctt gccccgtcct cccagctgcg tacgtggtgg       180
     aaccacgatc ctgagcgttt cgacgagttc gcaggccgct atgaagtcga gcttgacgag       240
     tccggtgccg cgaagacatt cctggaggaa tgtgccgggc gcgatgaggt gattttgctc       300
     tatggtgctg gtgatcgcga ggtcaatcac gctgttgtgc tggaacgcat ccttaccgag       360
     ctagctaact aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page