(data stored in ACNUC30630 zone)

EMBL: CP001977.PE438

CP001977.PE438       Location/Qualifiers
FT   CDS_pept        474228..475241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00784"
FT                   /db_xref="GOA:D4HB86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB86"
FT                   /protein_id="ADE00784.1"
FT                   /translation="MSWPSCDIEGWWLQSCRFETGAMDKPAIEIRDLVKSFPQTGSRER
FT                   LIAVDHLSMTINRGEVVAFLGPNGAGKSTTVDMLLGMTRPDSGKVSVLGSDPRTAARTG
FT                   CISAVFQTGGLLPDFTVAETMKAIAAAHGQRSRVKPLIERWELAPFAGTKVGKCSGGQR
FT                   QRLRFALAMLPKPDVLILDEPTTGLDVEARRHFWQVMGEEADAGRTVIFATHYIEEADS
FT                   FARRVVLVSGGQLVADGPINEVRASVSGSIVRATLTDPSGLAEGLHTFPGINDVTVRGQ
FT                   QLIVHTSQPDDLARYLLAHTDAHGLLISTTTLEDAFVRLTGSNDSRDDADDWEAAA"
     atgtcatggc caagttgtga cattgaagga tggtggctcc agtcttgtcg attcgagact        60
     ggagccatgg acaaaccagc gatagagata cgcgatctcg tcaagtcgtt cccccaaacc       120
     ggcagccgcg aacgcctcat tgccgtcgac cacttgtcaa tgacgatcaa ccgcggagag       180
     gtcgtggcct tcctcgggcc taacggagcc ggcaaatcca cgaccgtcga catgcttctt       240
     ggcatgacca gacccgacag tgggaaggtc agtgtcctgg gctccgatcc gagaacagcc       300
     gcacgtactg gttgcatcag cgccgtcttt caaaccggcg ggctgctacc cgacttcacc       360
     gtcgcagaga ccatgaaggc catcgctgcc gcacacgggc agcgttcgag ggtcaagccc       420
     ctcatcgaaa ggtgggagtt ggccccattc gccggaacca aggtcggcaa atgctcgggg       480
     ggtcagcggc agcgacttcg tttcgccctc gcgatgctgc ctaaacccga tgtgcttatc       540
     ctcgacgagc cgacaaccgg cctggacgtt gaggctcgtc gccatttctg gcaggtcatg       600
     ggtgaggagg ccgacgccgg gcgtacggtc attttcgcca cccactacat cgaggaggcc       660
     gattccttcg cccgtcgcgt cgtcctcgtc agtggtggac agctcgtcgc ggacggtccc       720
     atcaatgagg ttcgcgcctc ggtgtccgga tccattgtca gggcgaccct caccgatccc       780
     tccggactgg ccgagggtct gcacaccttc cctgggatta acgacgtcac cgtccggggc       840
     cagcaactca tcgtgcacac tagtcagcct gacgacctgg ctcgttacct tctggcccac       900
     accgacgctc acggactgct catctcgacg acgacccttg aggacgcctt cgtccggctc       960
     acaggctcca atgattcccg tgacgatgct gacgactggg aggcagcagc atga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page