(data stored in ACNUC30630 zone)

EMBL: CP001977.PE442

CP001977.PE442       Location/Qualifiers
FT   CDS_pept        complement(478115..478684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3450"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01113"
FT                   /db_xref="GOA:D4HB90"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB90"
FT                   /protein_id="ADE01113.1"
FT                   /translation="MSRIVIVRHGQSTWNRQGRIQGQTMGVRLTMRGRSQARQAARTVA
FT                   DLVPHGTPTIASDQKRAVQTARPIARVLGVQVMTDPRLREQGLGAMEGHTADELEPLPQ
FT                   PTGVHPADVRWAGGESLADVAERCHSLLDDLAARHLSAIALVTHGDTMRILLGILDGRS
FT                   HRDLDWDLSLTNGSVMVRNVDLGELH"
     gtgagccgca tcgtcatcgt caggcacgga cagtcaacat ggaatcgtca aggacgcatc        60
     caaggacaga ccatgggtgt tcggctaacg atgcgcggac gaagtcaggc tcgccaggcc       120
     gctcgcacgg tggcagatct ggtgccccac ggcaccccga ccatcgcctc ggaccagaag       180
     cgagcagtgc aaacggcccg tcccatcgca cgagttttgg gagtgcaggt gatgacggat       240
     ccgcggctgc gagagcaggg gctgggggcc atggaggggc acaccgccga tgagctcgaa       300
     cctctccccc agccaacggg ggtacatccg gccgacgtgc gatgggccgg cggggagtcg       360
     ctcgcagatg tggctgagcg gtgtcacagc ctgctggacg acttagcagc tcgtcatctg       420
     tcggcaatcg cgctcgtcac gcacggtgac actatgcgga tcctactggg gattctcgat       480
     ggtcgtagtc accgggacct cgactgggat ctctcgttga cgaacggaag cgtcatggta       540
     cgaaatgtgg acctgggcga attacattga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page