(data stored in ACNUC30630 zone)

EMBL: CP001977.PE465

CP001977.PE465       Location/Qualifiers
FT   CDS_pept        complement(502462..503214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3474"
FT                   /product="precorrin-6x reductase CbiJ/CobK"
FT                   /EC_number="1.3.1.54"
FT                   /note="identified by match to protein family HMM PF02571"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99806"
FT                   /db_xref="GOA:D4HBP7"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP7"
FT                   /protein_id="ADD99806.1"
FT                   /translation="MDVLILGGTTKARQLATRLIDEGVDLCSSLAGRTKSPRPVPGPTR
FT                   VGGFGGIDGLKEFLTDNEVKVMVDASHPFAAAMHGHAAQACRDLNLPLARLAPPSWRTQ
FT                   PEAATWHWVDDHDGATQVLADLPDVILLTVGRQPVSHYLRLGPRRVIVRCVDAPEEELP
FT                   AGWKVLRERGPFTLDREREIFSQGVATLVSKDSGGTGLDPKLRLAAETDVQVVMVSRGP
FT                   APGWGDELSTVDDAVQWTGNHIATVIEQ"
     atggacgtcc tcattctcgg cggtacgacg aaggcccggc agttagccac ccgattgatc        60
     gatgaggggg tagacctgtg cagctcgtta gcggggcgca cgaagtcccc ccggccagtt       120
     cctggcccga ctcgggtggg tggtttcggc ggcatcgacg gtctcaaaga attcctgact       180
     gacaacgaag tcaaggtcat ggtggatgcc tcccacccct tcgcagcagc tatgcacggc       240
     cacgccgctc aagcatgccg cgacctcaac cttccgctgg cacggctggc accaccaagc       300
     tggcgtaccc aacctgaggc agcgacctgg cactgggttg acgaccacga cggtgctact       360
     caagtcttag ctgacttacc cgacgtcatc ctgctgacag tgggacgcca acccgtcagc       420
     cactacctga gactcggccc acgtcgggtg atcgtgcgct gcgtcgatgc ccccgaggag       480
     gagcttcccg caggctggaa ggtactgcgg gagcgtggtc cgttcaccct cgaccgcgag       540
     cgagagattt tctcgcaggg tgtggctacc ctcgtctcca aggattccgg aggcaccggt       600
     ctcgacccta aactcaggtt ggcggccgaa accgacgtcc aggtcgtcat ggtctcacgt       660
     ggtccggcgc ccggctgggg ggatgagctc agtaccgttg acgacgcagt gcagtggaca       720
     ggaaaccaca tcgccaccgt gattgagcag taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page