(data stored in ACNUC30630 zone)

EMBL: CP001977.PE469

CP001977.PE469       Location/Qualifiers
FT   CDS_pept        complement(506927..508564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00097"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ1"
FT                   /protein_id="ADE00097.1"
FT                   /translation="MKSHKLLTFAVAAIMATSGLSTMIPTQSALASGPSQGAQSQHVGP
FT                   MTCVPFSGRPGSSGQLPLGVIPPNWGTDGWQRMDSTSRSDLPSKIVMRDNTEGFNQRMD
FT                   FALRDGKVYGRFQSENQWRHIDTPSCLDGHISAISVNDAMLAAVDSNGWVYSLNNLLSS
FT                   PKDWGWFRAWGSPFWFGRGLKLDNHDQGWWALSLIDNQTDRTYRGVDGHDHPISLAMCT
FT                   EIMMVSKDGAHIYQHDPWLPNDYSFEASTPYNSRFRVHSMSASGSVALITNDHGDMFTR
FT                   LWDYDIAGTDPAQFRYTWQDQSNLPSPSTWLQGKVDPRYAAIKLPPAGWKHQPKIPGEI
FT                   TDRLTVVSTAPGSQNRELRVEGRREGHTGYWSKMIDAKAWKFVPTGQNLKGKPLDNPQR
FT                   DTSKVDLGSASGLNYSGNLQGKANINIKDFAYQSTTRTIELTVGEKKYPVKLHSIDGRL
FT                   KTTLSMLSHRERGLTSTPRYYDAAIEVPDSYLKDPDFSPFMKGYLKGEKVHELYLEVTK
FT                   DSFKVINDRHPEIALRNGRNVSTLDRAK"
     atgaaatcac acaaactact cacgtttgcg gtggctgcaa tcatggctac ctccggcctc        60
     agcaccatga ttcctactca gtccgctctc gcgtctggac catcgcaggg ggcacagagc       120
     caacacgttg gtcccatgac gtgtgtgccc ttctccgggc gccccggtag ctcgggacaa       180
     ctccccctcg gagtcatccc accaaactgg ggaactgacg gttggcaacg aatggattcc       240
     accagccgct ccgatctgcc cagcaagatt gtgatgcgtg acaacaccga gggtttcaac       300
     cagcgcatgg atttcgccct gcgtgacggc aaagtgtacg gacgtttcca atccgagaat       360
     cagtggcgtc acatcgacac gccatcctgc ctcgacggac atatctcagc catctccgtc       420
     aatgacgcca tgctggccgc tgtcgattcc aacggttggg tgtatagcct taataatttg       480
     ctctcctctc ctaaggactg gggctggttc cgagcatggg gcagcccatt ctggtttggc       540
     cgtgggctca agctcgacaa ccacgaccaa ggttggtggg ccctgtccct catcgacaac       600
     cagaccgacc gcacctatcg cggtgtcgac ggtcatgatc acccaatctc gttggcgatg       660
     tgcaccgaaa tcatgatggt ctccaaagac ggagctcaca tttaccagca cgatccctgg       720
     ctgccgaacg actactcctt cgaggcttca accccgtaca actcgaggtt ccgtgtgcat       780
     tccatgtccg cgtcggggtc agtggcgctg atcacgaatg atcacggcga catgttcacg       840
     aggctctggg actacgacat cgccgggacc gatcccgccc agttccgcta cacctggcag       900
     gaccagagta atcttcccag tccttccacg tggctgcagg gcaaggtcga tcctcgctac       960
     gctgccatca aacttccacc ggccgggtgg aagcatcagc cgaagatccc cggcgagatc      1020
     accgacaggc ttaccgtggt gtcaaccgct cccggatccc agaaccggga acttcgtgtc      1080
     gagggacgtc gtgagggtca taccggttac tggtccaaga tgattgacgc gaaagcctgg      1140
     aagttcgttc ccaccggtca gaatctcaag ggcaagcccc ttgacaaccc acagcgcgat      1200
     acgtcgaaag tggatctcgg atctgccagc gggctcaact actcgggaaa tctgcagggc      1260
     aaggcgaaca tcaacatcaa agacttcgcc taccaatcga cgacccgaac gatcgagctc      1320
     acggtgggtg agaaaaaata tccggtaaag ctccactcga ttgacggccg cctcaagacg      1380
     accttgtcaa tgctgagcca ccgggaacgt gggctcacga gcaccccacg gtactacgac      1440
     gcagccatcg aggttcctga ctcctatctc aaagacccgg atttttcgcc tttcatgaag      1500
     ggatacctca aaggagagaa agtccatgag ctttacctgg aggtgacgaa ggattcattc      1560
     aaggtgatca acgacagaca ccccgaaatc gcgctacgta acggacgaaa cgtttccacc      1620
     cttgaccggg cgaagtaa                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page