(data stored in ACNUC30630 zone)

EMBL: CP001977.PE477

CP001977.PE477       Location/Qualifiers
FT   CDS_pept        513189..513635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3487"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99987"
FT                   /db_xref="GOA:D4HBQ9"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ9"
FT                   /protein_id="ADD99987.1"
FT                   /translation="MVVSKKFDDLLGMLGAIVFFLVIVILVMALFIMIPALFALVFQEC
FT                   YLDSPWTWETVVLGGLVLFALGMGVSLLMGVLARVVAPLTHPVVNRVFKEILEFLVLWW
FT                   FYSTLMHPTSYAFWASIVVMIMTTVTEPILDRAIERQKHAPNQP"
     gtggtagtat ctaagaaatt cgatgatttg ctggggatgt taggcgcaat tgtctttttt        60
     ctcgtcatcg ttattcttgt tatggccctc ttcattatga ttccagcgtt gttcgccttg       120
     gtgtttcagg agtgctatct agattcgccg tggacatggg agactgttgt cctgggcgga       180
     ttagtgctgt ttgcactggg gatgggtgtt tccctgctca tgggggtgtt ggcgagggtc       240
     gtcgccccct tgactcatcc tgtggtcaac agggtcttta aagagattct tgagttcctt       300
     gtgctttggt ggttttattc cactctcatg cacccgacta gctatgcttt ttgggcgagc       360
     attgtggtga tgattatgac cactgttacc gaacccattc tcgatagggc catcgaacga       420
     cagaagcacg cccccaacca accttga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page