(data stored in ACNUC30630 zone)

EMBL: CP001977.PE479

CP001977.PE479       Location/Qualifiers
FT   CDS_pept        complement(514306..515487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="HMPREF0675_3489"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by match to protein family HMM PF01238;
FT                   match to protein family HMM TIGR00218"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01005"
FT                   /db_xref="GOA:D4HBR1"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR1"
FT                   /protein_id="ADE01005.1"
FT                   /translation="MKRLTGTVRTYSWGSYDAIPDILGKEADGKPWAEYWLGAHETSPS
FT                   TLDGIPLTDYIHAHPDELGDRSRKVFGARLPFLLKILSAYHPLSLQAHPDAAMARAGFA
FT                   RENQDGIGVDDPHRTFVDDWPKPEILVALSDFEGLCGFRDPHETRQLFDELEVLTPTDP
FT                   VLGSLTERSGSAALAETFLNCLAGDDVRRQIVTEVVSGAVNHVGEDTPLGEFARTAVEL
FT                   DEYFPGDPSILAALMLNRVHLKPGQALSVPPGLMHSYLSGTGIEIMADSNNVVRGGLTN
FT                   KHIDIDSLIQIVSFQTQEPRIIAAEEVDPGMRVFPGIDDQFRLWQLDLDTTCPAMMPAS
FT                   ELARILLITDGYAVCSGSHGTDEIVRGQAVWIPAGERVQIDGDCDGFIAAAGL"
     atgaaacgcc tgaccggaac ggttcggacg tactcctggg gctcctacga tgcgatccca        60
     gacatcctcg gaaaagaggc tgacggaaag ccgtgggccg aatactggct cggggcccat       120
     gagacctcgc cgtcgaccct cgatggcata ccgctcaccg actacatcca cgctcaccct       180
     gacgaactcg gtgatcgcag ccgaaaagtc ttcggtgccc gcttaccctt tctcctcaaa       240
     atcctctcgg cctaccaccc gttaagtctg caagctcatc ctgacgccgc gatggcacgg       300
     gctggattcg ctcgagagaa ccaggacggc attggcgttg acgaccccca ccgcaccttc       360
     gtcgacgatt ggcccaagcc cgagattctc gtcgccctca gcgattttga ggggttgtgc       420
     ggattccgcg atccgcacga gacccgtcag ctgttcgatg agctagaggt cctcaccccg       480
     actgacccgg tgttgggatc gctgaccgaa cgttccggtt cggccgccct tgccgaaacc       540
     ttcctcaact gcctcgcggg ggacgacgta cggcgtcaga tcgtcaccga ggtggtctca       600
     ggagccgtca accacgtagg agaggacaca cccctgggag agttcgctcg caccgccgtc       660
     gagctcgacg agtattttcc cggggacccc tcgatcctgg cagcgctcat gctcaatcga       720
     gttcacctga aaccgggcca ggcgctgtct gtacccccgg gactcatgca ctcataccta       780
     tcgggcacgg gcattgagat catggccgat tccaacaatg tcgtgcgggg cggactcacc       840
     aacaagcaca ttgacatcga ttccctcatc caaatcgtct cgttccagac ccaggagcca       900
     cggatcattg cggcggagga ggtagacccg ggaatgcgcg tattcccggg cattgacgac       960
     cagttccgac tctggcagct cgacctcgac accacctgcc ccgccatgat gccggcaagc      1020
     gagctagctc gaatactcct cattacggat gggtatgcgg tctgttcagg ctctcatgga      1080
     actgacgaga tcgtacgcgg tcaggccgtc tggattccgg ctggtgaacg ggtacaaatt      1140
     gacggagact gcgacggatt tattgctgcc gccgggcttt aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page