(data stored in ACNUC30630 zone)

EMBL: CP001977.PE485

CP001977.PE485       Location/Qualifiers
FT   CDS_pept        521040..521927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3495"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /note="identified by match to protein family HMM PF01791"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00500"
FT                   /db_xref="GOA:D4HBR7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR7"
FT                   /protein_id="ADE00500.1"
FT                   /translation="MTRTPLIDKLLDRRLADPVRFADRVRQRPRATWSPTEPLMVVAAD
FT                   HPARGALAAGGRADAMADREHLLERCVTALGRPGVNGFLGTADMVADLANLDALGGKVV
FT                   FGSMNRGGFAGASFELDDRMTGYDVQGILDEDLTGGKMLLRFDLSDPGTATTAQACAEA
FT                   VTTLARARRIAMVEPFISYRADDGKVVNDLSADAVVKSVVMASGLGADTSWTWLKLPAV
FT                   DDMERVVRATSLPILLLGGEVSTDPEETRRRWATALAARHVRGLVLGRSVLYPPDSDVA
FT                   TAIDNAVQLLGVQA"
     atgacgcgca ccccgcttat tgacaagctg ttagatcggc gacttgccga tccggtgcgt        60
     tttgccgatc gcgtccggca gcgtccccga gcgacgtgga gccccactga accgctgatg       120
     gtcgtcgcgg ctgatcatcc tgctcgcggt gcactcgcag cgggaggtcg tgccgatgcc       180
     atggctgacc gggaacacct cctcgagcgc tgcgtgaccg cattaggacg tcccggggtc       240
     aatgggtttc tgggaactgc cgacatggtt gccgacctgg cgaacctcga cgctctaggt       300
     ggcaaggttg tattcggttc gatgaaccga ggagggttcg ctggagcttc cttcgagctc       360
     gacgaccgaa tgacgggcta cgacgtgcaa ggaatccttg acgaggatct gaccggtggc       420
     aagatgctgc tgaggttcga tctatccgac ccaggtacgg ctaccacggc acaggcctgt       480
     gctgaggctg tgacgactct ggccagggcg aggcgaattg ccatggtgga accgttcatc       540
     tcctaccgtg ctgacgatgg caaggtcgtc aacgatcttt ccgctgacgc ggttgtgaaa       600
     tcggtggtca tggcttcggg tcttggcgcc gatacctcgt ggacctggct caaattgccc       660
     gcggttgacg atatggagcg ggtggtacga gccacctcgc tgcccattct cctgcttggg       720
     ggagaggtga gcacggatcc tgaggagacc cggcgtcgtt gggccacggc actggccgca       780
     cgccatgtcc gtggactcgt cttgggacga tcggtcctct atccgccgga ctcggacgtg       840
     gcaactgcca ttgacaacgc tgttcaattg ttgggagtac aagcatga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page